KEGG   Bacillus subtilis subsp. subtilis 168: BSU36570
Entry
BSU36570          CDS       T00010                                 

Symbol
ywnG
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DUF5362 DUF4225 EI24 HRG Trp_oprn_chp
Other DBs
NCBI-GeneID: 936941
NCBI-ProteinID: NP_391538
Pasteur: BG12485
BSORF: BG12485
UniProt: P71042 A0A6M3ZJX3
Position
3761182..3761700
AA seq 172 aa
MISLDKDENEIEHHNEENSLVEQETAPVGQESRQLSASAVKSLSDIAKWGKISGILLIIM
GSLVTLSVLMTVIGAIPGVLLIISGVFLMRSAKAAAEAEGNLTGSAGESMLENYGTFIKM
QLFYAASSIVTVLIGIIVAIFVLVVIGIAAFENTPSYDDPDSYYYEDDPVFE
NT seq 519 nt   +upstreamnt  +downstreamnt
atgattagtctggataaagatgaaaacgaaattgaacatcataatgaagaaaatagcctt
gttgaacaggagactgcacctgttggacaggagagccgccagctgagcgcctccgctgtc
aagtcgctatccgacattgccaagtggggcaaaatttctggcatcttgttaatcattatg
ggatcgcttgtcactctgtctgttttgatgacagtgattggcgccatcccgggcgtactg
ctcattatttcaggcgtatttttgatgcgctcagcaaaagcagccgcggaagccgaagga
aatctaaccggcagcgctggcgaaagcatgcttgaaaattacgggacatttataaaaatg
cagctgttttatgcagcatccagtatcgttactgtcctgatcgggatcattgtagccatt
ttcgtgctggtggtaatcggcattgctgcttttgagaacacgccttcgtatgatgatccg
gattcttattattatgaggatgatccggtgtttgaataa

DBGET integrated database retrieval system