KEGG   Bacillus subtilis subsp. subtilis 168: BSU36580
Entry
BSU36580          CDS       T00010                                 

Symbol
ywnF
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DUF5392 DUF2776 SufE
Other DBs
NCBI-GeneID: 936942
NCBI-ProteinID: NP_391539
Pasteur: BG12484
BSORF: BG12484
UniProt: P71041
Position
complement(3761987..3762421)
AA seq 144 aa
MNFYRVEQMPGFIKTEMQKIQKAVQPFMKKTVIYRFLAIPLAAFSLFNLAAFLFHASADR
ESLISAGIFALLAALGLAFFKEAGYQHKQIQKTVHIYMLNRIKKSEILSEERKSSYARQI
KEEPFAMRSFVEFLTEEDRRKKMY
NT seq 435 nt   +upstreamnt  +downstreamnt
atgaacttttacagagtcgaacaaatgccggggttcatcaaaacagaaatgcaaaaaatt
caaaaggccgtacagcctttcatgaaaaaaaccgtcatttaccgttttcttgctattccg
cttgctgcattctctctctttaatttagctgcttttctatttcatgcttcagctgacagg
gagtccctgatcagcgcaggcatattcgcccttttggcggcgctcgggctcgcatttttt
aaagaggcaggctatcagcataaacaaatccaaaaaacggttcacatctatatgctgaac
aggatcaaaaagagcgaaatcctttcagaagagcggaaaagctcctacgcacgacaaata
aaggaagagccttttgcgatgcggagttttgttgaatttttgactgaggaagacagacgc
aaaaaaatgtattaa

DBGET integrated database retrieval system