KEGG   Bacillus subtilis subsp. subtilis 168: BSU36610
Entry
BSU36610          CDS       T00010                                 

Symbol
ywnC
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DUF5362 DUF3169 DUF4064 DUF3784 DUF4400 CRPA
Other DBs
NCBI-GeneID: 936950
NCBI-ProteinID: NP_391542
Pasteur: BG12481
BSORF: BG12481
UniProt: P71038 A0A6M4JPY4
Position
3765051..3765434
AA seq 127 aa
MNPETMNKTLISISKWGKATGILFIIMGAITALSGAFFFLIGAVPGVLQIISGIFLMRSA
REAGQMAEHNSGQSEDLMLENYAKFVKMQGIYLIVSIAVSILAIIAFFIFLMLGIADGLF
SDTYSTY
NT seq 384 nt   +upstreamnt  +downstreamnt
atgaatcctgaaacaatgaacaaaaccctcatcagcatttcgaaatggggaaaagctaca
ggcattttatttattattatgggcgcaattaccgcgctttcaggcgcgttcttttttcta
atcggtgccgtgccaggcgtactgcaaattatttccggtatctttttgatgaggtcagct
agggaagcaggccaaatggctgaacacaatagcggacagtctgaagacttaatgctggag
aattacgcgaaattcgtaaagatgcaagggatttatttgatcgtaagcattgctgtatcc
attcttgcgattatcgccttcttcatctttttaatgcttgggattgctgacggccttttc
agcgatacgtacagcacttattaa

DBGET integrated database retrieval system