KEGG   Bacillus subtilis subsp. subtilis 168: BSU36620
Entry
BSU36620          CDS       T00010                                 

Symbol
ywnB
Name
(RefSeq) hypothetical protein
  KO
K07118  uncharacterized protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    BSU36620 (ywnB)
SSDB
Motif
Pfam: NAD_binding_10 NmrA DapB_N Epimerase RmlD_sub_bind Semialdhyde_dh ChuX_HutX HemS DFP Rimk_N
Other DBs
NCBI-GeneID: 936961
NCBI-ProteinID: NP_391543
Pasteur: BG12480
BSORF: BG12480
UniProt: P71037 A0A6M4JPZ8
Position
complement(3765469..3766110)
AA seq 213 aa
MKIGIIGASGKAGNEILKEAKKRGHEVTAIVRNASKVQEQDVAILEKDVFELTAEDIKPF
DAVVNAFGAAPGQEHLHVEAGRALISILKDAKHTRLLVVGGAGSLFVDEAKTTRLMDTPE
FPKEYLPTASNQGENLKDLQQTDSISWTFLSPAAFFDPAGKRTGSYQKGKDNVIVNAKGD
SYISYADYAIAVLDELEHPEHKNERFTVVSEAE
NT seq 642 nt   +upstreamnt  +downstreamnt
atgaaaattggtattataggcgcaagcgggaaagcgggaaacgagattttgaaagaagcg
aaaaaaagaggccatgaagtgacagccatcgtcagaaacgcttcaaaagtgcaggagcaa
gacgtagcgattttggaaaaagatgtgtttgaactgactgcggaagacatcaagcctttc
gacgcggtcgtaaacgcttttggagcagcacccggccaagaacatcttcatgttgaagca
ggaagagcactcatcagcattttaaaggacgcgaagcacacaagattgcttgttgttggc
ggagcgggaagcctgtttgttgatgaagccaaaacaacccgtttaatggatacgccggaa
tttccgaaagaatatttgccaactgcatcaaatcaaggcgagaacctgaaagatttgcag
cagacagactccatttcctggacgttcctcagtcctgcggcattttttgatccagcagga
aaacggactggctcttaccaaaaaggaaaagacaatgtcatcgtaaatgcaaaaggagac
agctatatcagctatgcagattatgccattgccgtgttggacgagcttgaacatcccgaa
cacaaaaatgaacgcttcacagtggtaagcgaagcggaataa

DBGET integrated database retrieval system