KEGG   Bacillus subtilis subsp. subtilis 168: BSU36630
Entry
BSU36630          CDS       T00010                                 

Gene name
ywnA
Definition
(RefSeq) HTH-type transcriptional regulator YwnA
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Rrf2 HrcA_DNA-bdg HTH_Crp_2
Other DBs
NCBI-GeneID: 936952
NCBI-ProteinID: NP_391544
Pasteur: BG12479
BSORF: BG12479
UniProt: P71036 A0A6M4JQ35
Structure
PDB: 
1XD7

Position
complement(3766178..3766579)
AA seq 133 aa
MINSRLAVAIHILSLISMDEKTSSEIIADSVNTNPVVVRRMISLLKKADILTSRAGVPGA
SLKKDPADISLLEVYRAVQKQEELFAVHENPNPKCPVGKKIQNALDETFESVQRAMENEL
ASKSLKDVMNHLF
NT seq 402 nt   +upstreamnt  +downstreamnt
atgattaacagccgtcttgctgttgccattcatattttatccctcatctcgatggatgaa
aaaacatcttcagaaatcattgcagacagtgtcaacacgaatccggtagttgtgcgaaga
atgatcagcctgctgaaaaaagctgatattctcacatcacgcgccggggtgccgggtgca
agcctcaaaaaagatcctgctgatatttctcttttagaagtgtaccgggctgtccaaaag
caagaagaactctttgcggttcatgaaaacccgaatccgaaatgtccggtagggaaaaaa
attcagaacgctctggatgaaacgtttgaaagtgtgcaaagagcgatggaaaatgaactg
gcaagcaagtcattaaaagatgttatgaatcatctcttttaa

DBGET integrated database retrieval system