KEGG   Bacillus subtilis subsp. subtilis 168: BSU36670
Entry
BSU36670          CDS       T00010                                 

Symbol
csbD
Name
(RefSeq) stress response protein CsbD
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: CsbD Apolipoprotein
Other DBs
NCBI-GeneID: 936969
NCBI-ProteinID: NP_391548
Pasteur: BG12478
BSORF: BG12478
UniProt: P70964 A0A6M4JQ00
Position
complement(3770104..3770292)
AA seq 62 aa
MGNDSVKDKMKGGFNKAKGEVKDKVGDMADRTDMQAEGKKDKAKGEIQKDIGKAKDKFSD
KD
NT seq 189 nt   +upstreamnt  +downstreamnt
atgggtaacgatagtgtaaaagacaaaatgaagggcggcttcaataaagccaaaggagaa
gtgaaggataaagtcggagatatggctgacagaacggacatgcaggctgaaggcaaaaaa
gataaggcaaaaggcgaaatccaaaaggatatcgggaaagccaaggataaattttcagat
aaagattaa

DBGET integrated database retrieval system