KEGG   Bacillus subtilis subsp. subtilis 168: BSU36680
Entry
BSU36680          CDS       T00010                                 

Symbol
ywmF
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Other DBs
NCBI-GeneID: 936974
NCBI-ProteinID: NP_391549
Pasteur: BG12477
BSORF: BG12477
UniProt: P70963
Position
complement(3770365..3770865)
AA seq 166 aa
MHVRGNSMFGFNDMVKFLWSFLIVLPLVQIIHVSGHSFMAFIFGGKGSLDIGMGKTLLKI
GPIRFRTIYFIDSFCRYGELKIDNRFSNALVYAGGCLFNLITIFAINLLIIHSVLKPNVF
FYQFVYFSTYYVFFALLPVRYSEKKSSDGLAIYKVLRYGERYEIDK
NT seq 501 nt   +upstreamnt  +downstreamnt
atgcatgtgagggggaattcaatgtttggttttaatgatatggtgaagtttctgtggtct
ttcctcattgttctgccgcttgtacagattatacatgtttcagggcacagctttatggct
tttatttttggcggaaagggatcgttggatataggcatgggaaaaacgctgcttaaaatt
ggacccatacggttcagaacgatttattttatcgattctttttgccggtacggggagttg
aaaattgacaatcgattctcaaatgcactcgtgtatgcagggggctgcttgtttaacctc
atcacgatttttgcaatcaatctgctgattatacacagtgtattaaagccgaatgtgttt
ttctatcagtttgtctatttttctacgtattatgtgttttttgccctgctgccggtccga
tattcggagaaaaagtcatcagacgggctggcgatatacaaggtgctccgttacggagag
cgctacgaaatcgataaataa

DBGET integrated database retrieval system