KEGG   Bacillus subtilis subsp. subtilis 168: BSU36700
Entry
BSU36700          CDS       T00010                                 

Symbol
moaA
Name
(RefSeq) cyclic pyranopterin monophosphate synthase
  KO
K03639  GTP 3',8-cyclase [EC:4.1.99.22]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00790  Folate biosynthesis
bsu01100  Metabolic pathways
bsu01240  Biosynthesis of cofactors
bsu04122  Sulfur relay system
Module
bsu_M00880  Molybdenum cofactor biosynthesis, GTP => molybdenum cofactor
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BSU36700 (moaA)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04122 Sulfur relay system
    BSU36700 (moaA)
Enzymes [BR:bsu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.99  Other carbon-carbon lyases
    4.1.99.22  GTP 3',8-cyclase
     BSU36700 (moaA)
SSDB
Motif
Pfam: Mob_synth_C Radical_SAM Fer4_14 Fer4_12 Radical_SAM_2
Other DBs
NCBI-GeneID: 936982
NCBI-ProteinID: NP_391551
Pasteur: BG10980
BSORF: BG10980
UniProt: P39757 A0A6M4JPZ4
Position
complement(3772325..3773350)
AA seq 341 aa
MITESRQMLDKRNRPLRDLRISVTDRCNFRCTYCMPAELFGPDYPFLKKEELLSFEELER
LATLFVTRFGVEKIRLTGGEPLMRKDMPELIKKLARIPGIRDIAMTTNGSLLPVYAKRLK
EAGLKRVTISLDSLEDERFKKINGRGVSVSKVLEGIEAAKQAGLGVKINMVVQKGVNEKD
ILPMARYFKEKGHILRFIEFMDVGNTNQWEKKDVMTKAEIIDLINKHMPVEPIAPNYIGE
VASRFRYLDGSGEIGVISSVSDAFCGSCNRARLSARGELFTCLFASSGFDLRAPVRQELS
DDELSEMIGTVWKNRIDQYSVDRTLSKASGKKKVEMSYIGG
NT seq 1026 nt   +upstreamnt  +downstreamnt
atgattacagagtcgcgtcagatgttggataaaagaaacagaccgctgagagaccttcgc
atttctgttacagaccgctgcaacttccgatgcacgtactgtatgcccgccgaattattc
ggcccggattatccttttttaaagaaagaggagctgctttcatttgaggagctggaacgg
cttgcgacattgtttgtcacaagatttggcgttgaaaaaatccgcttgaccggcggagag
cccctcatgagaaaggatatgccggaattaatcaaaaaactggcccgcataccgggtatt
cgtgacatcgcgatgacgacaaacggatcactgctgcctgtttatgctaagaggctcaag
gaggctgggctgaaaagggttacgatcagccttgattctttagaagacgagcgttttaag
aagataaacgggcgcggtgtttctgtcagcaaggtgctggaaggcattgaagcggcgaag
caagcggggctcggtgttaaaatcaatatggtcgttcaaaagggcgtcaatgaaaaagat
atactgcctatggcccgttattttaaagaaaaagggcatatcctgagattcattgaattt
atggacgtaggcaacaccaaccaatgggaaaagaaagacgtcatgacaaaggcggaaatc
atagatttgatcaataaacacatgccggttgagccgatagcgcctaattatataggcgaa
gtggcttccagattccgctacttggacggctccggagaaattggcgtcatatcatctgta
tctgatgcattctgcggatcttgcaacagagcccgtctttctgcgagaggagagctgttt
acctgcttattcgcttcaagcggatttgacctcagagctccggttcgccaggaattaagt
gatgacgaactatcagaaatgatcgggacagtatggaaaaatcggatcgatcagtattca
gtcgatcgtacgctatcaaaagcatctggcaaaaagaaagtggaaatgtcttatattggc
ggttaa

DBGET integrated database retrieval system