KEGG   Bacillus subtilis subsp. subtilis 168: BSU36710
Entry
BSU36710          CDS       T00010                                 

Symbol
fdhD
Name
(RefSeq) protein FdhD
  KO
K02379  FdhD protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99982 Energy metabolism
    BSU36710 (fdhD)
SSDB
Motif
Pfam: FdhD-NarQ
Other DBs
NCBI-GeneID: 936976
NCBI-ProteinID: NP_391552
Pasteur: BG10979
BSORF: BG10979
UniProt: P39756 A0A6M4JQ08
Position
complement(3773366..3774154)
AA seq 262 aa
MNDKVTAVRDVWRYEQGEISKVEDRMVTEFPLTVILNGSEFVTLVCTPEHIEELVIGFLA
SEGVIRFQKEIKRFTIDESLGFVYVDLVHPETLDQKDYTKRVIGSCCGKGRHFYFQQDVK
TAKTAVSQIKISPEACLALMKDMQQGSGTFQDTGGVHNAALCDTEKLLLMRTDIGRHNAL
DKLYGHCLLNGMSVRDKLIVFSGRISSEVLLKAAKIGVSIVISKSAPTELAIQMAEELNI
TAIGFVRNGSFNVYTHPERIRE
NT seq 789 nt   +upstreamnt  +downstreamnt
ttgaacgataaagtaactgcggtcagggatgtatggcgctatgaacaaggggaaataagc
aaagtagaagaccggatggtgacggaattccctttgacagtgatactgaatggcagtgaa
tttgtgacgctcgtttgtacgcctgagcatatcgaagagcttgtcatcggatttctcgca
tcagagggtgttatacgatttcaaaaagaaattaaaaggtttacaatagatgaaagtctc
ggttttgtatatgtcgacctcgttcaccctgagacattggatcaaaaggattatacgaaa
cgggtgatcggctcatgctgcggaaagggccgtcatttttattttcagcaggatgtcaaa
acagccaagacggctgtcagccaaatcaagatatcgcctgaggcatgtctggcgcttatg
aaagacatgcagcaagggagcgggacgtttcaggatacgggaggcgtccataatgcggcg
ctttgcgacacagagaagcttctgttgatgcgcacagatatcggtcggcacaacgcactt
gataaactatacggacactgccttctaaacgggatgtccgtacgcgacaaactgattgtg
ttcagcggcagaatctcatcagaggtcctgttaaaagcggccaaaatcggcgtgtcgatt
gtcatttccaaatcggccccgacggagcttgcgattcaaatggctgaagaattgaatatc
acagcgattggatttgtcagaaacggatcatttaatgtatatacacaccctgagagaatc
agggagtag

DBGET integrated database retrieval system