KEGG   Bacillus subtilis subsp. subtilis 168: BSU36720
Entry
BSU36720          CDS       T00010                                 

Gene name
ywmE
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Motif
Pfam: Phage_holin_3_6 DUF3784 DUF3487
Other DBs
NCBI-GeneID: 936977
NCBI-ProteinID: NP_391553
Pasteur: BG12476
BSORF: BG12476
UniProt: P70966 A0A6M4JQ46
Position
complement(3774400..3774561)
AA seq 53 aa
MKLFGMIFLIATVAFILLGVLLKLAAFFFVSILTLIAAIVLFTVLKKNQHNQT
NT seq 162 nt   +upstreamnt  +downstreamnt
atgaaattattcggaatgatttttcttatagccaccgttgcatttatattgcttggtgtt
cttctaaaactggcagccttcttttttgtcagcattctcaccttgatcgcagctattgtg
ctgtttacggttctgaaaaagaatcagcataatcaaacatag

DBGET integrated database retrieval system