KEGG   Bacillus subtilis subsp. subtilis 168: BSU36730
Entry
BSU36730          CDS       T00010                                 

Symbol
ywmD
Name
(RefSeq) hypothetical protein
  KO
K07114  Ca-activated chloride channel homolog
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU36730 (ywmD)
Transporters [BR:bsu02000]
 Other transporters
  Pores ion channels [TC:1]
   BSU36730 (ywmD)
SSDB
Motif
Pfam: VWA VWA_2 VWA_CoxE
Other DBs
NCBI-GeneID: 936987
NCBI-ProteinID: NP_391554
Pasteur: BG12475
BSORF: BG12475
UniProt: P70961 A0A6M3ZGX0
Position
complement(3774655..3775329)
AA seq 224 aa
MKKLLAAGIIGLLTVSIASPSFAAEKQADTNVAVLFDGSGSMVQKTGGERKIDIAKKSVK
SFAELLPKDTNLMLRVFGHAGNNKLSGKALSCSTTETIYGLHPYEGSLFDNSLSELKPTG
WTPIAKALADTRKEFEAFDADGKNVVYLITDGEETCGGDPAAEIEKLRASNVDTIVNIIG
FNFDVKGNEEMKQAAVAGGGEYISANSADEFEQAWEKEAQKFTE
NT seq 675 nt   +upstreamnt  +downstreamnt
atgaaaaaattgctggctgccggtatcattggattgttgactgtttccattgcctccccg
tcttttgccgctgagaaacaggctgatacaaatgtagctgttttgtttgacggaagcgga
agcatggttcaaaaaacaggaggagagcgcaaaatagacattgccaaaaaatcagtaaaa
tcttttgccgaacttcttccaaaggatacaaatcttatgcttcgcgttttcgggcatgca
gggaacaataaactgtccggtaaagccctttcgtgcagtacgacggaaaccatttacggc
cttcatccatatgaagggtctctgtttgacaattcattgagtgagctcaagccgactgga
tggacaccgattgccaaagcacttgcagacacaagaaaagaatttgaagcatttgacgca
gacgggaaaaacgtggtgtatttaatcactgacggtgaagaaacgtgcggcggagaccct
gcggcggaaatcgaaaagctccgtgcatcaaatgtggatacgattgtaaacatcattggc
ttcaactttgatgtcaagggtaatgaagagatgaaacaagcagctgtcgctggcggcgga
gaatatatttcagcgaacagtgcggatgagttcgaacaggcttgggaaaaagaagcacaa
aaatttactgagtaa

DBGET integrated database retrieval system