KEGG   Bacillus subtilis subsp. subtilis 168: BSU36740
Entry
BSU36740          CDS       T00010                                 

Gene name
ywmC
Definition
(RefSeq) hypothetical protein
  KO
K07114  Ca-activated chloride channel homolog
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU36740 (ywmC)
Transporters [BR:bsu02000]
 Other transporters
  Pores ion channels [TC:1]
   BSU36740 (ywmC)
Motif
Pfam: VWA VWA_2 DUF1194 vWA-TerF-like Ssl1 DUF241
Other DBs
NCBI-GeneID: 936990
NCBI-ProteinID: NP_391555
Pasteur: BG12474
BSORF: BG12474
UniProt: P70960 A0A6M3ZH46
Position
complement(3775653..3776336)
AA seq 227 aa
MKKRFSLIMMTGLLFGLTSPAFAAEKTETEAKAPANVAVLLDASGSMAKRIDGVSKFNSA
KKEISKFASSLPEGTQVKMSVFGSEGNNKNSGKVQSCEAIRNVYGFQSFNEQSFLNSLNT
IGPTGWTPIAKALNEAKSSFDQLDAKGEKVVYLLTDGEETCGGNPIKTAKELQKDNITVN
VIGFDYKEGYKGQLNAIAKVGGGEYFPAYTQKDVEKIFTQQSLMLSK
NT seq 684 nt   +upstreamnt  +downstreamnt
atgaagaaaagattttcactgatcatgatgacaggattgctttttggattaacttcacct
gcttttgcagctgaaaagacagaaacggaggctaaagcgccggcgaacgtggcggtcttg
cttgatgccagcggaagtatggcgaaaagaatagatggtgtatctaaatttaattcagcc
aaaaaagaaatttcaaagtttgcgagctcattgccagaaggaactcaggtgaaaatgagc
gtgtttggctctgaaggaaacaataaaaattccggaaaagttcagtcatgtgaagccatt
cgcaacgtatacggcttccaaagctttaacgagcaaagcttcctcaattctctcaataca
attgggccgactggctggacgccaattgccaaagcgctgaacgaggcgaaatcttctttt
gaccagcttgatgcaaaaggggaaaaagtggtgtatctgttgacagacggtgaggaaacg
tgcggaggaaacccgattaaaacagcaaaggaactgcaaaaagacaatatcactgttaat
gtgatcggctttgattataaagagggatacaaaggccagctgaacgcaattgcgaaagta
ggcggcggtgaatacttcccggcttatacccaaaaagatgttgagaaaattttcactcag
caatcactaatgttatctaaataa

DBGET integrated database retrieval system