KEGG   Bacillus subtilis subsp. subtilis 168: BSU36750
Entry
BSU36750          CDS       T00010                                 

Gene name
spoIID
Definition
(RefSeq) stage II sporulation protein D
  KO
K06381  stage II sporulation protein D
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99978 Cell growth
    BSU36750 (spoIID)
Motif
Pfam: SpoIID DUF1444 Ly49
Other DBs
NCBI-GeneID: 936979
NCBI-ProteinID: NP_391556
Pasteur: BG10766
BSORF: BG10766
UniProt: P07372 A0A6M3ZJZ2
Position
complement(3776722..3777753)
AA seq 343 aa
MKQFAITLSVLCALILLVPTLLVIPFQHNKEAGASVESEKTAVSTKPASKGAETLKASPV
SIPVYRTANQSVENIPLEEYVIGVVASEMPATFKPEALKAQALAARTFIVRLMVSNSAVE
APKGSLVDDTQMFQVYKSKAELKKQWGTSYETKLKKITDAVASTQGKILTYNNQPIEASF
FSTSNGYTENAEAYWTSAIPYLKSVKSPWDKKSPKYKATKTFTAAEFQQKLGVKLDGSSA
VGKITGETPGHQVATAVINGKTLKGRDIREKLGLNSADFEWKRNGDTITVTTRGFGHGVG
MSQYGANFMAKEGKTVDDIVKYYYQGTQISEADAFLNKYMAKK
NT seq 1032 nt   +upstreamnt  +downstreamnt
atgaaacaattcgcaatcacactatccgtactatgtgcattgattctcttggttcccaca
ctcttggttataccattccagcataataaggaagcgggggccagcgtagaatcagaaaag
acagcagtcagcacgaaaccagcatcgaaaggagcagaaacattgaaagcatcacctgtt
tctattcccgtctatcgaaccgcaaatcaatccgtagaaaacattccgcttgaagagtat
gtgattggagtcgtcgcctccgaaatgccggcaacctttaaacctgaagcgctgaaagcc
caggcgcttgccgccagaacatttattgtcagactgatggtgtcaaattcagcggtagaa
gctcctaaaggctcactggtggatgatacacagatgttccaggtgtataaaagcaaagcg
gagctgaaaaaacagtggggcacaagctatgagacaaaactgaagaaaatcacagatgcg
gtagccagtacgcaaggcaaaatcttaacgtacaacaaccagccgattgaagcatccttt
ttctccacaagcaacggctacacagagaatgcagaagcttattggacaagtgctatccca
tatttaaaaagcgtcaaaagcccatgggataaaaagtctccgaaatataaggcaacgaaa
acctttacagcggcagaatttcagcaaaagcttggcgtcaagctggatggatctagcgca
gtagggaagattaccggcgagacaccgggccaccaggtcgcaactgccgtcattaacggc
aagacgctgaaaggaagagacatacgtgaaaagttgggtctcaactccgccgattttgaa
tggaagcgaaatggagacacaattacagtcacgacgagaggatttggccacggtgtgggg
atgagccaatacggagcgaattttatggccaaagaaggcaaaacggttgatgacattgta
aagtactattaccaaggcacacaaatttctgaggcagatgcgtttttgaataaatatatg
gcgaaaaagtag

DBGET integrated database retrieval system