KEGG   Bacillus subtilis subsp. subtilis 168: BSU36770
Entry
BSU36770          CDS       T00010                                 

Symbol
ywmB
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DUF1779
Other DBs
NCBI-GeneID: 936983
NCBI-ProteinID: NP_391558
Pasteur: BG12473
BSORF: BG12473
UniProt: O32277 A0A6M3ZLB8
Structure
PDB: 
2FPN

Position
complement(3779293..3780033)
AA seq 246 aa
MKKKQVSHAIIISVMLSFVIAVFHTIHASELTPLAQMAEGMERQDVSIDKWTLHAKQNLS
LTEKEFYQKVQRLKQEYRQYDWVIAREDKMIKAIGTYTDKKNRTSFRLQLVTTLKKHNPT
SYLLYEQMSLETPDSWNDTYEQFERETLGIFQEKVVIFTCLNGHLDDNMNIVLQKKANQL
LNEFQARSVEHVVEPNFVSISAFTDEWEEYIMTSKHKMNLQIALRSAGMGGKHTVTVGTP
IVTTEY
NT seq 741 nt   +upstreamnt  +downstreamnt
atgaagaaaaaacaagtaagccacgctattatcatttccgtcatgttaagcttcgtcatt
gctgttttccataccattcatgcgagtgaattaacgccgttagcacagatggcagagggg
atggaacgtcaagatgtgtcaatagataagtggacattgcatgcaaaacaaaacttgtca
ctgaccgaaaaagaattttatcaaaaagtgcaacgtttaaaacaagagtatcgtcaatat
gattgggtgattgcacgggaagataaaatgataaaggcaattggcacatatactgacaaa
aaaaatcgtacttcttttagactgcagcttgtcacaaccctcaaaaaacacaatccaact
tcgtatttattatatgagcaaatgagtctagagacaccggatagctggaatgatacatat
gaacagtttgaacgggagacacttgggatattccaagaaaaagtagttatttttacttgt
ctaaatggtcacttagatgataatatgaatattgttttgcaaaaaaaagcaaatcagtta
ttaaatgaatttcaagcaagatcagtagaacatgtagttgagccaaatttcgtttctatt
tctgcgtttacagatgagtgggaagagtacattatgacctcgaaacataaaatgaatttg
caaattgcacttagaagtgcaggaatgggcggaaaacataccgttacggttggcacacca
atcgttacgactgaatattaa

DBGET integrated database retrieval system