KEGG   Bacillus subtilis subsp. subtilis 168: BSU36780Help
Entry
BSU36780          CDS       T00010                                 

Gene name
ywzB
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF1146
Motif
Other DBs
NCBI-GeneID: 936986
NCBI-ProteinID: NP_391559
Pasteur: BG14163
BSORF: BG14163
UniProt: O32278
Position
complement(3780162..3780392)
Genome map
AA seq 76 aa AA seqDB search
MSVLGQQAAIGIVVHLIFIAVTWWALQAVNIDPLIKKGKVVQARLLMILLTIAIGTAVAN
FFLDYLNYSQQLPYLF
NT seq 231 nt NT seq  +upstreamnt  +downstreamnt
atgagtgtattgggacagcaggctgcaatcggcattgtcgttcacctgatttttatagca
gtgacttggtgggcgttgcaagccgtcaatatagatccgttaatcaaaaaaggcaaagtc
gtgcaggcaagactcctgatgattttgctgacaatcgccattggaacggccgttgccaat
ttctttttagattacctcaattattcacagcagcttccctatctattttaa

DBGET integrated database retrieval system