KEGG   Bacillus subtilis subsp. subtilis 168: BSU36780
Entry
BSU36780          CDS       T00010                                 

Symbol
ywzB
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DUF1146
Other DBs
NCBI-GeneID: 936986
NCBI-ProteinID: NP_391559
Pasteur: BG14163
BSORF: BG14163
UniProt: O32278 A0A6M4JQ44
Position
complement(3780162..3780392)
AA seq 76 aa
MSVLGQQAAIGIVVHLIFIAVTWWALQAVNIDPLIKKGKVVQARLLMILLTIAIGTAVAN
FFLDYLNYSQQLPYLF
NT seq 231 nt   +upstreamnt  +downstreamnt
atgagtgtattgggacagcaggctgcaatcggcattgtcgttcacctgatttttatagca
gtgacttggtgggcgttgcaagccgtcaatatagatccgttaatcaaaaaaggcaaagtc
gtgcaggcaagactcctgatgattttgctgacaatcgccattggaacggccgttgccaat
ttctttttagattacctcaattattcacagcagcttccctatctattttaa

DBGET integrated database retrieval system