KEGG   Bacillus subtilis subsp. subtilis 168: BSU36790
Entry
BSU36790          CDS       T00010                                 

Symbol
ywmA
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Sulfotransfer_1
Other DBs
NCBI-GeneID: 936991
NCBI-ProteinID: NP_391560
Pasteur: BG12472
BSORF: BG12472
UniProt: P70958 A0A6M4JQ02
Position
3780562..3781035
AA seq 157 aa
MNHSFFQPEKQYGEDLPIFDQEWEAIAFYYDYRQSQIEELNELCQFFNISLTYTRESLEE
LENLYFQSIQELLLADWNLPIEEFEKMISVYLIDCVIARHEDAEWVVKPYPYKDGAYTLG
FRRHRKSWHTMNACDGLYLRPKEDRPLLSLFDSLVRS
NT seq 474 nt   +upstreamnt  +downstreamnt
gtgaatcattctttttttcagcctgaaaagcaatatggtgaggacctgccaatttttgat
caggaatgggaagcaattgcattctattatgattatagacagtcacagattgaagaactg
aatgaattgtgtcagttttttaacatttctcttacctatacgagagaaagccttgaagag
cttgaaaacctctattttcaaagtatacaagaacttttgcttgctgattggaatcttcct
attgaagaattcgagaaaatgatcagtgtttatcttatagattgtgtgattgcccgccat
gaagatgctgaatgggttgtaaaaccttatccctataaagacggcgcttatacacttggc
tttagaagacatcgcaaatcgtggcatacaatgaatgcctgtgatggtttatacctgcgt
ccaaaagaggatcgcccgttgctgtcgctgtttgattctcttgtgcgttcataa

DBGET integrated database retrieval system