KEGG   Bacillus subtilis subsp. subtilis 168: BSU36800
Entry
BSU36800          CDS       T00010                                 

Symbol
atpC
Name
(RefSeq) ATP synthase epsilon chain
  KO
K02114  F-type H+-transporting ATPase subunit epsilon
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00190  Oxidative phosphorylation
bsu01100  Metabolic pathways
Module
bsu_M00157  F-type ATPase, prokaryotes and chloroplasts
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    BSU36800 (atpC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00194 Photosynthesis proteins [BR:bsu00194]
    BSU36800 (atpC)
Photosynthesis proteins [BR:bsu00194]
 Photosystem and electron transport system
  F-type ATPase [OT]
   BSU36800 (atpC)
SSDB
Motif
Pfam: ATP-synt_DE_N ATP-synt_DE DUF2642 DUF6286
Other DBs
NCBI-GeneID: 936994
NCBI-ProteinID: NP_391561
Pasteur: BG10822
BSORF: BG10822
UniProt: P37812 A0A6M3ZHD6
Position
complement(3781069..3781467)
AA seq 132 aa
MKTVKVNIVTPDGPVYDADIEMVSVRAESGDLGILPGHIPTVAPLKIGAVRLKKDGQTEM
VAVSGGFVEVRPDHVTILAQAAETAEGIDKERAEAARQRAQERLNSQSDDTDIRRAELAL
QRALNRLDVAGK
NT seq 399 nt   +upstreamnt  +downstreamnt
atgaagaccgttaaagtcaatatcgttactcccgacggcccagtatacgatgcggatatc
gaaatggtgagtgtgagagccgaaagcggcgatctcggtattttgccaggccatattcca
accgtggctcctcttaaaatcggcgctgtccgtctgaaaaaagacgggcagactgaaatg
gttgccgtcagcggcggttttgtagaagtccgtcctgatcatgtcaccatccttgcccag
gctgccgagacagcggaaggcatcgataaagagcgcgctgaagctgcacgccagcgggcg
caggagcgtttgaattctcaatcagatgatactgacattcgtcgggctgagcttgcgtta
cagcgggctttgaacagattggatgtagcagggaaataa

DBGET integrated database retrieval system