KEGG   Bacillus subtilis subsp. subtilis 168: BSU36820
Entry
BSU36820          CDS       T00010                                 

Symbol
atpG
Name
(RefSeq) ATP synthase gamma chain
  KO
K02115  F-type H+-transporting ATPase subunit gamma
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00190  Oxidative phosphorylation
bsu01100  Metabolic pathways
Module
bsu_M00157  F-type ATPase, prokaryotes and chloroplasts
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    BSU36820 (atpG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00194 Photosynthesis proteins [BR:bsu00194]
    BSU36820 (atpG)
Photosynthesis proteins [BR:bsu00194]
 Photosystem and electron transport system
  F-type ATPase [OT]
   BSU36820 (atpG)
SSDB
Motif
Pfam: ATP-synt GIT1_C
Other DBs
NCBI-GeneID: 936989
NCBI-ProteinID: NP_391563
Pasteur: BG10820
BSORF: BG10820
UniProt: P37810 A0A6M3ZGY1
Position
complement(3782938..3783801)
AA seq 287 aa
MASLRDIKSRITSTKKTSQITKAMQMVSAAKLNRAENNAKSFVPYMDKIQEVVSNVGRVS
GNVKHPMLLSREVKKTAYLVITSDRGLAGAFNSSVLRSAYQAMQERHQSKDEYAVIAIGR
VGRDFFKKREIPIISELTGLGDEVTFTEIKDLARQTIQMFIDGAFDELHLVYNHFVSAIT
QEVTEKKLLPLSDLGSGGGKRTASYEFEPSEEEVLEVLLPQYAESLIFGALLDSKASEHA
ARMTAMKNATDNAKELIDSLSLSYNRARQAAITQEITEIVGGAAALE
NT seq 864 nt   +upstreamnt  +downstreamnt
ttggcctcattacgcgatattaagtcaaggatcacgtcaacgaaaaaaacaagtcagatt
acaaaagccatgcagatggtatctgcggctaagctgaatcgtgctgaaaacaatgcaaaa
tcatttgtgccatatatggataaaatccaagaggttgtgtcaaacgtcggaagagtttcc
ggcaacgtgaagcacccgatgcttctcagcagagaagtgaaaaaaacggcataccttgtc
attacgtctgaccgcggtcttgccggcgcttttaacagttcggttttacggagtgcttat
caggccatgcaagaacgtcatcagtctaaggatgagtatgcggtgattgccatcggaaga
gtgggccgtgatttctttaagaaacgggagattccgatcatttccgagttaacaggactt
ggagatgaagtaacgtttacagaaattaaagatcttgcccgtcaaacgattcaaatgttt
atagacggtgcgtttgatgaattgcaccttgtttataaccattttgtcagcgccattact
caagaagtaacggagaaaaaacttctgccgttatctgatttgggcagcggcggcggaaaa
agaacggcgtcttatgaatttgaaccatctgaagaggaggttctggaggttttgcttcct
caatatgcagaaagcttaatcttcggtgcgcttcttgacagtaaagcaagtgagcacgct
gcaagaatgacggcgatgaaaaacgcgacagacaacgcgaaggaacttatcgattcactt
tcgctttcttacaaccgcgctcgccaagcagccatcacacaagaaattacggaaattgtc
ggcggagcagccgctttagaatag

DBGET integrated database retrieval system