KEGG   Bacillus subtilis subsp. subtilis 168: BSU36830
Entry
BSU36830          CDS       T00010                                 

Gene name
atpA
Definition
(RefSeq) ATP synthase subunit alpha
  KO
K02111  F-type H+/Na+-transporting ATPase subunit alpha [EC:7.1.2.2 7.2.2.1]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00190  Oxidative phosphorylation
bsu01100  Metabolic pathways
Module
bsu_M00157  F-type ATPase, prokaryotes and chloroplasts
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    BSU36830 (atpA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00194 Photosynthesis proteins [BR:bsu00194]
    BSU36830 (atpA)
Enzymes [BR:bsu01000]
 7. Translocases
  7.1  Catalysing the translocation of hydrons
   7.1.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.1.2.2  H+-transporting two-sector ATPase
     BSU36830 (atpA)
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.1  Na+-transporting two-sector ATPase
     BSU36830 (atpA)
Photosynthesis proteins [BR:bsu00194]
 Photosystem and electron transport system
  F-type ATPase [OT]
   BSU36830 (atpA)
Motif
Pfam: ATP-synt_ab ATP-synt_ab_C ATP-synt_ab_N HAS-barrel Arginosuc_synth
Other DBs
NCBI-GeneID: 936995
NCBI-ProteinID: NP_391564
Pasteur: BG10819
BSORF: BG10819
UniProt: P37808 A0A6M4JQ33
Position
complement(3783878..3785386)
AA seq 502 aa
MSIKAEEISTLIKQQIQNYQSDIEVQDVGTVIQVGDGIARVHGLDNCMAGELVEFSNGVL
GMAQNLEESNVGIVILGPFSEIREGDEVKRTGRIMEVPVGEELIGRIVNPLGQPVDGLGP
ILTSKTRPIESPAPGVMDRKSVHEPLQTGIKAIDALIPIGRGQRELIIGDRQTGKTSVAI
DAILNQKDQDMICVYVAIGQKESTVRGVVETLRKHGALDYTIVVTASASQPAPLLYLAPY
AGVTMAEEFMYNGKHVLVVYDDLSKQAAAYRELSLLLRRPPGREAFPGDVFYLHSRLLER
AAKLSDAKGAGSITALPFVETQAGDISAYIPTNVISITDGQIFLQSDLFFSGVRPAINAG
LSVSRVGGSAQIKAMKKVSGTLRLDLASYRELEAFAQFGSDLDQATQAKLNRGARTVEVL
KQDLNKPLPVEKQVAILYALTKGYLDDIPVADIRRFEEEYYMYLDQNHKDLLDGIAKTGN
LPADEDFKAAIEGFKRTFAPSN
NT seq 1509 nt   +upstreamnt  +downstreamnt
gtgagcatcaaagctgaagagattagcacgctgataaaacagcaaatacaaaattatcaa
tctgatattgaagttcaagacgtaggtacagtcatccaagtcggtgacggtattgcacgt
gtgcacggccttgacaactgtatggccggtgaacttgtcgaattttcaaacggtgttttg
ggtatggctcaaaaccttgaggaatcaaacgtaggtatcgtcatcttaggacctttcagt
gagatccgtgagggagacgaagtaaaaagaacaggccgcatcatggaggttcctgttggt
gaagagttaatcggccgtattgtaaacccgctaggccagccggttgacggactaggcccg
attctgacaagcaaaactcgtccgatcgaaagccctgcaccaggcgttatggaccgtaaa
tccgttcatgaaccgcttcaaaccggtatcaaagcgatcgatgcactgattccaatcggc
cgcggccagcgtgagctgatcatcggtgaccgtcaaacaggtaaaacatctgttgcgatc
gatgcgatcctgaaccaaaaagaccaagacatgatctgtgtatatgttgcgatcggccaa
aaagaatcaacagtccgcggcgtagtagaaacattgcgtaaacacggcgcgcttgattat
acaattgttgtaacggcgtctgcgtcacagccggcaccgcttctgtacctggcaccgtat
gctggggttacaatggcagaagaatttatgtacaacggcaagcacgttcttgttgtatac
gatgatctttctaaacaagcggccgcttaccgtgagctgtccttgcttcttcgccgtccg
ccaggccgtgaagcgttccctggggatgtattctatcttcattcccgtctgcttgagcgt
gcagcaaagcttagcgacgcgaaaggcgcaggatcaattacagctctgccgttcgtagaa
acacaagccggagatatctctgcttatattccgacgaacgtcatttccatcaccgacgga
cagatcttcctgcaatctgatttgttcttctcaggcgtacgtccagcgatcaatgccgga
ttgtctgtatcccgtgtcggcggctcagcgcaaatcaaagcgatgaaaaaagtatcaggt
actttgcgtcttgaccttgcgtcataccgtgagctggaagcattcgctcaattcggttct
gacctcgaccaagcgactcaggcaaaactgaaccgcggtgcgcgtacagttgaagtgctg
aagcaggatctgaacaagccgcttccggttgaaaagcaagtagctattctttatgcgctg
acaaaaggatatctcgatgatattcctgtggcggatatcagacgttttgaagaagagtac
tacatgtaccttgaccaaaaccataaagacctgcttgacggaattgcgaaaacaggaaac
cttcctgctgatgaagacttcaaagctgcaatcgaaggcttcaaacgcacatttgcacca
agcaactaa

DBGET integrated database retrieval system