KEGG   Bacillus subtilis subsp. subtilis 168: BSU36850
Entry
BSU36850          CDS       T00010                                 

Symbol
atpF
Name
(RefSeq) ATP synthase subunit b
  KO
K02109  F-type H+-transporting ATPase subunit b
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00190  Oxidative phosphorylation
bsu01100  Metabolic pathways
Module
bsu_M00157  F-type ATPase, prokaryotes and chloroplasts
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    BSU36850 (atpF)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00194 Photosynthesis proteins [BR:bsu00194]
    BSU36850 (atpF)
Photosynthesis proteins [BR:bsu00194]
 Photosystem and electron transport system
  F-type ATPase [OT]
   BSU36850 (atpF)
SSDB
Motif
Pfam: ATP-synt_B PEP-utilisers_N FUT8_N_cat PIN_8
Other DBs
NCBI-GeneID: 936998
NCBI-ProteinID: NP_391566
Pasteur: BG10817
BSORF: BG10817
UniProt: P37814 A0A6M3ZK01
Position
complement(3785945..3786457)
AA seq 170 aa
MSQLPLELGLSFNGGDILFQLLAMLILLALLKKYALGPLLNIMKQREDHIAGEITSAEEK
NKEAQQLIEEQRVLLKEARQESQTLIENAKKLGEKQKEEIIQAARAESERLKEAARTEIV
KEKEQAVSALREQVASLSVMIASKVIEKELDEQAQEKLIQDYLKEVGESR
NT seq 513 nt   +upstreamnt  +downstreamnt
atgtctcaattaccacttgaactaggattgtcgtttaacggcggagatatcctgttccaa
ctgttagctatgttaatcttattagcgcttctgaagaaatacgctttagggccgctatta
aacataatgaaacagcgtgaagaccacatcgctggagaaattacgtctgctgaagaaaaa
aataaagaagcgcagcagctgattgaagagcagcgcgttcttttaaaagaagcaagacag
gaatcccaaactcttatcgaaaacgcaaagaaactgggagagaagcaaaaagaagagatt
attcaggctgcacgtgcagaatctgaacgtctgaaagaagcagcaagaactgaaatcgtg
aaggaaaaggaacaggcggtttctgctctccgtgagcaagtagcgtctctttctgtcatg
attgcgtcgaaagtgatcgaaaaagaactggatgaacaagcgcaagagaaattgatccag
gactatcttaaagaggtaggagaaagccgatga

DBGET integrated database retrieval system