KEGG   Bacillus subtilis subsp. subtilis 168: BSU36860
Entry
BSU36860          CDS       T00010                                 

Symbol
atpE
Name
(RefSeq) ATP synthase subunit c
  KO
K02110  F-type H+-transporting ATPase subunit c
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00190  Oxidative phosphorylation
bsu01100  Metabolic pathways
Module
bsu_M00157  F-type ATPase, prokaryotes and chloroplasts
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    BSU36860 (atpE)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00194 Photosynthesis proteins [BR:bsu00194]
    BSU36860 (atpE)
Photosynthesis proteins [BR:bsu00194]
 Photosystem and electron transport system
  F-type ATPase [OT]
   BSU36860 (atpE)
SSDB
Motif
Pfam: ATP-synt_C DUF3918
Other DBs
NCBI-GeneID: 936999
NCBI-ProteinID: NP_391567
Pasteur: BG10816
BSORF: BG10816
UniProt: P37815 A0A6M4JQ20
Position
complement(3786620..3786832)
AA seq 70 aa
MNLIAAAIAIGLGALGAGIGNGLIVSRTVEGIARQPEAGKELRTLMFMGIALVEALPIIA
VVIAFLAFFG
NT seq 213 nt   +upstreamnt  +downstreamnt
atgaatttaatagcagctgcgattgcaattggtttaggcgcacttggtgcaggtattggt
aacggtttgattgtttcacgtacggtagaggggattgcccgtcagccggaagcaggtaaa
gaactgagaactcttatgttcatgggtatcgcattagttgaagcccttcctattatcgct
gtcgttatcgcattcttagcgttctttggctaa

DBGET integrated database retrieval system