KEGG   Bacillus subtilis subsp. subtilis 168: BSU36870
Entry
BSU36870          CDS       T00010                                 

Symbol
atpB
Name
(RefSeq) ATP synthase subunit a
  KO
K02108  F-type H+-transporting ATPase subunit a
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00190  Oxidative phosphorylation
bsu01100  Metabolic pathways
Module
bsu_M00157  F-type ATPase, prokaryotes and chloroplasts
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    BSU36870 (atpB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00194 Photosynthesis proteins [BR:bsu00194]
    BSU36870 (atpB)
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:bsu03110]
    BSU36870 (atpB)
Photosynthesis proteins [BR:bsu00194]
 Photosystem and electron transport system
  F-type ATPase [OT]
   BSU36870 (atpB)
Chaperones and folding catalysts [BR:bsu03110]
 Other chaperones and cochaperones
  PapD
   BSU36870 (atpB)
SSDB
Motif
Pfam: ATP-synt_A
Other DBs
NCBI-GeneID: 937004
NCBI-ProteinID: NP_391568
Pasteur: BG10815
BSORF: BG10815
UniProt: P37813 A0A6M3ZLC2
Position
complement(3786878..3787612)
AA seq 244 aa
MNHGYRTIEFLGLTFNLTNILMITVASVIVLLIAILTTRTLSIRPGKAQNFMEWIVDFVR
NIIGSTMDLKTGANFLALGVTLLMYIFVSNMLGLPFSITIGHELWWKSPTADPAITLTLA
VMVVALTHYYGVKMKGLKEYSKDYLRPVPFMLPMKIIEEFANTLTLGLRLYGNIFAGEIL
LGLLAGLATSHYSQSVALGLVGTIGAILPMLAWQAFSLFIGAIQAFIFTMLTMVYMSHKI
SHDH
NT seq 735 nt   +upstreamnt  +downstreamnt
ttgaatcatggttacagaactatagaatttctaggtcttacttttaatctgacaaacatt
ctgatgattactgtggcgagtgtgattgttttattgattgctatattgacgacaagaacg
ctttcgatccgtcccggaaaagcccagaactttatggaatggattgttgatttcgtccgc
aatattattggcagtacaatggatttaaaaacaggggctaacttcttggcacttggtgtc
acattgctgatgtacatatttgtgtcgaatatgctggggctgccgttctctattacaatc
ggacatgagctctggtggaagtctccgacagccgatcctgccattacattaacgctagcc
gtgatggttgttgctttaacccactactatggtgtgaagatgaaagggctcaaggaatat
tccaaagactatttaagacctgttccattcatgctcccgatgaaaatcatcgaagagttt
gcgaatacgctgactctaggtttgcggctgtatggtaacatcttcgccggtgagattctt
ctcggcctgcttgcgggattagcaacaagccattattcgcaaagcgtggctctcggtctt
gtcggtacaatcggtgccattctgccgatgctggcatggcaagcattcagtttatttatt
ggtgctatccaggcatttatctttacaatgctgacgatggtgtacatgtctcataaaatc
agtcatgatcattaa

DBGET integrated database retrieval system