KEGG   Bacillus subtilis subsp. subtilis 168: BSU36880Help
Entry
BSU36880          CDS       T00010                                 

Gene name
atpI
Definition
(RefSeq) ATP synthase protein I
  KO
K02116  ATP synthase protein I
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00194 Photosynthesis proteins [BR:bsu00194]
    BSU36880 (atpI)
Photosynthesis proteins [BR:bsu00194]
 Photosystem and electron transport system
  F-type ATPase [OT]
   BSU36880 (atpI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-synt_I NDUF_B4 NDUFV3
Motif
Other DBs
NCBI-GeneID: 937003
NCBI-ProteinID: NP_391569
Pasteur: BG10814
BSORF: BG10814
UniProt: P37816
Position
complement(3787620..3788003)
Genome map
AA seq 127 aa AA seqDB search
MDDPKLTFSRQRKYLLFILAVYVLGYGLTAYKTVFLGLILGTVFSLFNFLLLVRRMNAFD
RAVEKGKSIRSLGSAARWCNAILAVAVAYKNPEYFHMASTVIGLMTIYPVIMIDSFIQLK
RSSMEER
NT seq 384 nt NT seq  +upstreamnt  +downstreamnt
atggacgatcccaagcttacatttagcagacaacgcaaatatttattgttcattttggca
gtgtatgtactgggttatggtttaacagcgtataaaaccgtttttttaggccttattctg
ggaactgttttcagtttgtttaattttttactgctcgtcagaagaatgaatgcttttgac
agagctgtagagaaaggaaagtccatacgatctctcgggagcgcagcgcggtggtgcaat
gcgattcttgctgtggctgttgcctataaaaatcccgaatactttcatatggcaagtaca
gttattggattaatgacaatataccctgtcattatgatagattcctttatccagcttaaa
cgttcatcaatggaagagaggtga

DBGET integrated database retrieval system