KEGG   Bacillus subtilis subsp. subtilis 168: BSU36890
Entry
BSU36890          CDS       T00010                                 

Gene name
upp
Definition
(RefSeq) uracil phosphoribosyltransferase
  KO
K00761  uracil phosphoribosyltransferase [EC:2.4.2.9]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00240  Pyrimidine metabolism
bsu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    BSU36890 (upp)
Enzymes [BR:bsu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.9  uracil phosphoribosyltransferase
     BSU36890 (upp)
SSDB
Motif
Pfam: UPRTase Pribosyltran
Other DBs
NCBI-GeneID: 937006
NCBI-ProteinID: NP_391570
Pasteur: BG10945
BSORF: BG10945
UniProt: P39149 A0A6M3ZI06
Position
complement(3788426..3789055)
AA seq 209 aa
MGKVYVFDHPLIQHKLTYIRNENTGTKDFRELVDEVATLMAFEITRDLPLEEVDINTPVQ
AAKSKVISGKKLGVVPILRAGLGMVDGILKLIPAAKVGHVGLYRDPETLKPVEYYVKLPS
DVEEREFIVVDPMLATGGSAVEAIHSLKKRGAKNIRFMCLVAAPEGVEELQKHHSDVDIY
IAALDEKLNEKGYIVPGLGDAGDRMFGTK
NT seq 630 nt   +upstreamnt  +downstreamnt
atgggaaaggtttatgtatttgatcatcctttaattcagcacaagctgacatatatacgg
aatgaaaatacaggtacgaaggattttagagagttagtagatgaagtggctacactcatg
gcatttgaaattacccgcgatcttcctctggaagaagtggatatcaatacaccggttcag
gctgcgaaatcgaaagtcatctcagggaaaaaactcggagtggttcctatcctcagagca
ggattgggaatggttgacggcattttaaagctgattcctgcggcaaaagtgggacatgtc
ggcctttaccgtgatccagaaaccttaaaacccgtggaatactatgtcaagcttccttct
gatgtggaagagcgtgaattcatcgtggttgacccgatgctcgctacaggcggttccgca
gttgaagccattcacagccttaaaaaacgcggtgcgaaaaatatccgtttcatgtgtctt
gtagcagcgccggagggtgtggaagaattgcagaagcatcattcggacgttgatatttac
attgcggcgctagatgaaaaattaaatgaaaaaggatatattgttccaggtctcggagat
gcgggtgaccgcatgtttggaacaaaataa

DBGET integrated database retrieval system