KEGG   Bacillus subtilis subsp. subtilis 168: BSU36900
Entry
BSU36900          CDS       T00010                                 

Symbol
glyA
Name
(RefSeq) serine hydroxymethyltransferase
  KO
K00600  glycine hydroxymethyltransferase [EC:2.1.2.1]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00260  Glycine, serine and threonine metabolism
bsu00460  Cyanoamino acid metabolism
bsu00630  Glyoxylate and dicarboxylate metabolism
bsu00670  One carbon pool by folate
bsu00680  Methane metabolism
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01120  Microbial metabolism in diverse environments
bsu01200  Carbon metabolism
bsu01230  Biosynthesis of amino acids
bsu01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    BSU36900 (glyA)
  09102 Energy metabolism
   00680 Methane metabolism
    BSU36900 (glyA)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BSU36900 (glyA)
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    BSU36900 (glyA)
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    BSU36900 (glyA)
Enzymes [BR:bsu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.1  glycine hydroxymethyltransferase
     BSU36900 (glyA)
SSDB
Motif
Pfam: SHMT Aminotran_1_2 Beta_elim_lyase Aminotran_5 Cys_Met_Meta_PP DegT_DnrJ_EryC1 OKR_DC_1
Other DBs
NCBI-GeneID: 937015
NCBI-ProteinID: NP_391571
Pasteur: BG10944
BSORF: BG10944
UniProt: P39148 A0A6M4JQ13
Position
complement(3789190..3790437)
AA seq 415 aa
MKHLPAQDEQVFNAIKNERERQQTKIELIASENFVSEAVMEAQGSVLTNKYAEGYPGKRY
YGGCEHVDVVEDIARDRAKEIFGAEHVNVQPHSGAQANMAVYFTILEQGDTVLGMNLSHG
GHLTHGSPVNFSGVQYNFVEYGVDKETQYIDYDDVREKALAHKPKLIVAGASAYPRTIDF
KKFREIADEVGAYFMVDMAHIAGLVAAGLHPNPVPYADFVTTTTHKTLRGPRGGMILCRE
EFGKKIDKSIFPGIQGGPLMHVIAAKAVSFGEVLQDDFKTYAQNVISNAKRLAEALTKEG
IQLVSGGTDNHLILVDLRSLGLTGKVAEHVLDEIGITSNKNAIPYDPEKPFVTSGIRLGT
AAVTSRGFDGDALEEVGAIIALALKNHEDEGKLEEARQRVAALTDKFPLYKELDY
NT seq 1248 nt   +upstreamnt  +downstreamnt
atgaaacatttacctgcgcaagacgaacaagtgtttaacgccattaaaaatgagcgtgaa
cgccaacagactaagatcgaattgattgcttctgagaactttgtaagtgaagcggttatg
gaagcacaaggatctgttttgacaaataagtacgcagaaggatatccgggcaaacgctac
tacggcggatgcgagcacgtcgatgtcgttgaagatatcgcccgtgaccgcgcgaaggaa
atctttggagcggagcatgtaaacgttcagcctcattcaggcgcacaagcaaacatggca
gtgtacttcacgattttggagcaaggcgatactgtacttgggatgaacctctcccacggc
ggccatttaacacacggaagcccagtcaacttcagcggtgttcaatataactttgttgag
tacggcgtagataaagaaactcaatatattgattacgatgacgtgcgtgaaaaagccctc
gctcataaaccgaagcttatcgtagcaggagcaagtgcgtatcctcgtacaatcgacttt
aagaaattccgtgaaattgctgatgaagtcggcgcttacttcatggtggatatggcacat
atcgcaggacttgttgcggcaggccttcatccaaacccggttccttacgctgatttcgtt
acaacaacaacacataaaacacttcgcggtcctcgcggcggtatgatcctttgccgtgaa
gagtttggcaagaaaattgataaatcgatcttccctggaattcaaggcggccctctgatg
cacgttattgccgcaaaagctgtttcattcggtgaagtattgcaggacgatttcaaaaca
tatgcacaaaacgtcatttcaaacgcgaaacgtctggctgaagccttaacgaaagagggc
atccagctcgtttcaggcggaacagacaaccaccttatccttgttgaccttcgttcgctc
ggactgactggtaaggttgcggagcatgtacttgatgaaattggtattacgtctaacaaa
aacgcgattccatatgatcctgaaaaacctttcgtaacaagcggcatccgtcttggtaca
gctgctgtaaccagccgcggttttgacggagacgcattagaagaagtcggtgctatcatt
gcgcttgcattgaaaaaccacgaagatgaaggaaaacttgaagaagcaagacagcgtgta
gctgctctgactgataaatttcctttatataaagaattagattattaa

DBGET integrated database retrieval system