KEGG   Bacillus subtilis subsp. subtilis 168: BSU36910
Entry
BSU36910          CDS       T00010                                 

Symbol
ywlG
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DUF436
Other DBs
NCBI-GeneID: 937007
NCBI-ProteinID: NP_391572
Pasteur: BG10943
BSORF: BG10943
UniProt: P39157 A0A6M4JQ29
Position
complement(3790644..3791186)
AA seq 180 aa
MNELKQTWKTMLSEFQDQAELKQDQLFVLGCSTSEVAGSRIGTSGSVDIAESIYSGLAEL
REKTGIHLAFQCCEHLNRALVVEAETAKLFRLPTVSAVPVPKAGGAMASYAFKQMKSPVL
VETIQADAGIDIGDTFIGMHLKPVAVPVRVSQNSLGSAHVTLARTRPKLIGGVRAVYECE
NT seq 543 nt   +upstreamnt  +downstreamnt
atgaatgagttgaaacaaacgtggaagacgatgctgtctgagtttcaggaccaagcggaa
ttgaaacaagatcagctcttcgtccttggatgcagcacgagcgaagtggccggcagccgg
atcggcacatcgggcagtgtagatatcgctgaaagcatctacagcggacttgctgagctc
cgggaaaaaacgggaatccatctggcgtttcaatgctgcgagcatttaaacagagcgctt
gtcgtcgaagcagaaacagccaagctgttcaggcttccaaccgtttctgccgtgcccgtt
ccaaaagcgggcggagcgatggcgtcttatgcgtttaagcagatgaagtctcctgttctt
gttgaaaccattcaggctgacgccggaattgatataggcgatacgtttatcggcatgcat
ctgaaaccggtggctgtccctgtgcgtgtctctcaaaacagcctcggttcagctcatgtg
acattggcgcgtacacggccgaaactaatcggcggagtgcgggcggtttatgagtgcgaa
tga

DBGET integrated database retrieval system