KEGG   Bacillus subtilis subsp. subtilis 168: BSU36920
Entry
BSU36920          CDS       T00010                                 

Symbol
ywlF
Name
(RefSeq) sugar phosphate isomerase YwlF
  KO
K01808  ribose 5-phosphate isomerase B [EC:5.3.1.6]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00030  Pentose phosphate pathway
bsu00051  Fructose and mannose metabolism
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01120  Microbial metabolism in diverse environments
bsu01200  Carbon metabolism
bsu01230  Biosynthesis of amino acids
Module
bsu_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
bsu_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    BSU36920 (ywlF)
   00051 Fructose and mannose metabolism
    BSU36920 (ywlF)
Enzymes [BR:bsu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.6  ribose-5-phosphate isomerase
     BSU36920 (ywlF)
SSDB
Motif
Pfam: LacAB_rpiB
Other DBs
NCBI-GeneID: 937014
NCBI-ProteinID: NP_391573
Pasteur: BG10942
BSORF: BG10942
UniProt: P39156 A0A6M4JQ63
Position
complement(3791199..3791648)
AA seq 149 aa
MKVAIASDHGGVHIRNEIKELMDELQIEYIDMGCDCGSGSVDYPDYAFPVAEKVVSGEVD
RGILICGTGIGMSISANKVKGIRCALAHDTFSAKATREHNDTNILAMGERVIGPGLAREI
AKIWLTTEFTGGRHQTRIGKISDYEEKNL
NT seq 450 nt   +upstreamnt  +downstreamnt
atgaaagtagccattgcatcggatcatggcggcgttcacattcgaaatgaaatcaaagag
ttaatggacgaattgcaaattgaatatattgatatgggctgtgactgcggcagcggctct
gtcgattatccggattatgcttttccggtggccgaaaaagtggttagcggcgaagttgac
agaggcattttaatttgcgggacaggcatcggcatgagcatttccgctaataaagtaaaa
gggattcgctgcgcgctggcgcacgataccttcagcgcgaaggcgacgagggagcataat
gacacaaacatccttgcgatgggtgaacgggtgatcggacctggtttggctcgggaaatc
gcaaaaatctggctgactactgagtttaccgggggaagacaccaaacgcgtattggaaaa
atctccgattatgaagagaaaaacctgtag

DBGET integrated database retrieval system