KEGG   Bacillus subtilis subsp. subtilis 168: BSU36930
Entry
BSU36930          CDS       T00010                                 

Symbol
ywlE
Name
(RefSeq) low molecular weight protein-tyrosine-phosphatase YwlE
  KO
K20201  protein arginine phosphatase [EC:3.9.1.2]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BSU36930 (ywlE)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.9  Acting on phosphorus-nitrogen bonds
   3.9.1  Acting on phosphorus-nitrogen bonds (only sub-subclass identified to date)
    3.9.1.2  protein arginine phosphatase
     BSU36930 (ywlE)
SSDB
Motif
Pfam: LMWPc
Other DBs
NCBI-GeneID: 937021
NCBI-ProteinID: NP_391574
Pasteur: BG10941
BSORF: BG10941
UniProt: P39155 A0A6M3ZGZ2
Structure
PDB: 
4ETN 4KK3 4KK4 4ETI 1ZGG

Position
complement(3791805..3792257)
AA seq 150 aa
MDIIFVCTGNTCRSPMAEALFKSIAEREGLNVNVRSAGVFASPNGKATPHAVEALFEKHI
ALNHVSSPLTEELMESADLVLAMTHQHKQIIASQFGRYRDKVFTLKEYVTGSHGDVLDPF
GGSIDIYKQTRDELEELLRQLAKQLKKDRR
NT seq 453 nt   +upstreamnt  +downstreamnt
atggatattatttttgtctgtactggaaatacgtgccgcagcccaatggctgaggcgctt
tttaaatcaattgcagaaagggaagggctgaatgtcaatgtccgctcggcaggcgtgttt
gcttcacctaatgggaaagcgacgcctcatgcagtcgaagcgctgtttgaaaaacacatt
gcccttaatcatgtgtcttctccattaactgaagaacttatggaatcggctgatttggtt
ctggctatgacccatcagcacaaacagatcattgccagccaatttggacgttatcgtgat
aaagtgtttacgttaaaagaatatgtcacaggcagccatggtgatgtcctcgatccgttc
ggcggctcaattgacatctataaacaaacgcgagatgagcttgaagagcttcttcggcag
ctggcaaaacagctgaaaaaagaccgtagataa

DBGET integrated database retrieval system