KEGG   Bacillus subtilis subsp. subtilis 168: BSU36940
Entry
BSU36940          CDS       T00010                                 

Symbol
ywlD
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Mntp
Other DBs
NCBI-GeneID: 937022
NCBI-ProteinID: NP_391575
Pasteur: BG10940
BSORF: BG10940
UniProt: P39154 A0A6M4JQ43
Position
complement(3792333..3792890)
AA seq 185 aa
MSDLFIGELITLSIMAFALGMDAFSVGLGMGMVKLRKKQIFYIGFIIGLFHVIMPLAGMA
AGNMLSGLLGVLAVYIGGALLFVLGVQMLMASFKQSEERFMSPAGPGLLLFAIGVSLDSF
SVGLSLGIYGSHPLLTITLFGLFSMMLTWLGLLVGKQVQSWLGTYSEALGGIILIVFGLK
LLLPI
NT seq 558 nt   +upstreamnt  +downstreamnt
atgtcggatttgtttataggcgaactgattacattaagcatcatggcgtttgctttaggg
atggatgctttttctgtcggccttggaatgggcatggtcaaacttagaaagaagcagata
ttctatattggtttcatcatcggcctctttcacgtcatcatgcctctcgcagggatggcg
gccggtaacatgctgtcagggctcctcggcgtgttagcggtttatatcggtggggcgctg
ctttttgttcttggggttcaaatgcttatggcctcttttaaacagtcagaagaacgattc
atgtcaccggcagggccgggcttattgctgtttgccatcggcgtcagccttgacagcttt
tccgtcggcttgagcttggggatatacggctcgcatccgctcctcacaattaccctgttc
gggctgttcagcatgatgttgacatggctgggcctgctggtcggaaaacaagtgcagtca
tggcttggcacatacagcgaagcgctcgggggcatcatattaatcgtgtttggattaaag
ctgcttttgccaatttaa

DBGET integrated database retrieval system