KEGG   Bacillus subtilis subsp. subtilis 168: BSU36950
Entry
BSU36950          CDS       T00010                                 

Symbol
ywlC
Name
(RefSeq) tRNA threonylcarbamoyladenosine biosynthesis protein YwlC
  KO
K07566  L-threonylcarbamoyladenylate synthase [EC:2.7.7.87]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:bsu03009]
    BSU36950 (ywlC)
   03016 Transfer RNA biogenesis [BR:bsu03016]
    BSU36950 (ywlC)
Enzymes [BR:bsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.87  L-threonylcarbamoyladenylate synthase
     BSU36950 (ywlC)
Ribosome biogenesis [BR:bsu03009]
 Prokaryotic type
  Other maturation factors
   BSU36950 (ywlC)
Transfer RNA biogenesis [BR:bsu03016]
 Eukaryotic type
  tRNA modification factors
   Other tRNA modification factors
    BSU36950 (ywlC)
 Prokaryotic type
    BSU36950 (ywlC)
SSDB
Motif
Pfam: Sua5_yciO_yrdC SUA5
Other DBs
NCBI-GeneID: 937023
NCBI-ProteinID: NP_391576
Pasteur: BG10939
BSORF: BG10939
UniProt: P39153 A0A6M4JQ45
Position
complement(3792969..3794009)
AA seq 346 aa
MKTKRWFVDVTDELSTNDPQIAQAAALLRENEVVAFPTETVYGLGANAKNTDAVKKIYEA
KGRPSDNPLIVHIADISQLEDLTGPAPEKAKTLMKRFWPGALTLILPCKPDALSPRVTAG
LETVAIRMPDHPLALALIRESGLPIAAPSANLSGKPSPTKAEHVAHDLDGRIAGIVDGGP
TGIGVESTVLSCADDIPVLLRPGGITKEQIEAVIGPIHVDKGLSDQNEKPISPGMKYTHY
APTAPLAICEGSPERIQHLIQEYQQGGRRVGVLTTEEKAGVYSADYVKSCGRRAQLETVA
AGLYDALRSFDENKVDFIIAESFPDTGVGLAIMNRLMKAAGGRVIR
NT seq 1041 nt   +upstreamnt  +downstreamnt
atgaaaacgaaaagatggtttgtggatgtaactgacgagttatccacaaatgatccacaa
attgcacaagcagccgctttgctccgagaaaatgaggtcgttgcctttccgacagaaaca
gtatatggcctaggcgcaaacgcaaaaaatacggatgccgtcaaaaaaatatatgaggcg
aaagggcggccgagcgataatcccctgattgtccacattgcggatatcagccagcttgag
gatttaacgggcccggcgccggaaaaggcgaaaacattgatgaaacggttttggccggga
gcacttacgctcattctgccttgcaaacctgatgcgctttcacctcgtgtaacggcaggt
cttgaaacggttgccattagaatgccggatcatccgcttgcccttgcattgattcgcgaa
tcgggactgccgattgcagcaccgagcgccaatctatcaggcaagccaagtcccacaaaa
gcggagcatgtggctcacgacttggatggccgcatagccggtattgtggatggaggccct
accggaatcggggtcgaatcaactgtgctttcatgtgcggacgacatccctgttctcttg
cgtcctggcggcattacgaaggaacaaattgaagcggtgatcgggccgatccatgtggat
aaagggctcagcgaccaaaacgagaagccgatttctccagggatgaaatatacacattat
gcgccgacagcgcctcttgccatttgcgaaggcagcccagagcgcattcagcacctcatt
caagaatatcaacagggtggaagacgggtcggtgtcctgacgacagaagaaaaagcgggc
gtttattccgctgattatgtgaagagctgcggaagacgggctcagcttgagactgttgcg
gcagggctgtatgatgctttgcgcagctttgatgagaataaggtggatttcattatagcg
gaatcctttccggatacaggtgtcggtcttgctattatgaacaggctgatgaaagccgcc
ggaggaagagtgattcgctga

DBGET integrated database retrieval system