KEGG   Bacillus subtilis subsp. subtilis 168: BSU36960
Entry
BSU36960          CDS       T00010                                 

Gene name
ywlB
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Motif
Pfam: Acetyltransf_10 TrkA_N
Other DBs
NCBI-GeneID: 937028
NCBI-ProteinID: NP_391577
Pasteur: BG10938
BSORF: BG10938
UniProt: P39152 A0A6M3ZK03
Position
complement(3794166..3794609)
AA seq 147 aa
MFYQLRVAREKDGDVLEAFLKQAKTSYEGVKEGFTQFLMLEDSEKNIAGCLGIEKISCDQ
GLLRSLVISDKLHQGHIVTLFQSMEVLCEKHQIKTVYLVANQHSSADFLTAMGFERAESV
PEELFSSDHFCESRQTEGAVLMKKASG
NT seq 444 nt   +upstreamnt  +downstreamnt
atgttttatcaactgcgggtggcaagggaaaaagacggagatgtgctcgaggcattttta
aaacaggcaaaaaccagctatgaaggcgtgaaagaaggcttcactcaatttcttatgctg
gaggacagtgagaaaaacattgccggatgcctcggtattgaaaaaataagctgtgaccag
gggctgctgcgatcacttgtcatatcggacaagcttcaccaaggccacatcgtcacgctt
tttcaaagcatggaggtgctgtgcgaaaagcatcagatcaaaaccgtgtacctagtagca
aatcagcattcctctgcggactttctgacggccatgggttttgaaagagctgagagtgta
ccggaggagctgttttcttctgatcacttctgtgaatcgcggcaaacagaaggagccgtt
ttgatgaaaaaagcgtctggataa

DBGET integrated database retrieval system