KEGG   Bacillus subtilis subsp. subtilis 168: BSU36970
Entry
BSU36970          CDS       T00010                                 

Symbol
spoIIR
Name
(RefSeq) stage II sporulation protein R
  KO
K06387  stage II sporulation protein R
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99978 Cell growth
    BSU36970 (spoIIR)
SSDB
Motif
Pfam: Spore_II_R Spore_III_AF Peptidase_M41 ABC2_membrane_3
Other DBs
NCBI-GeneID: 937017
NCBI-ProteinID: NP_391578
Pasteur: BG10937
BSORF: BG10937
UniProt: P39151 A0A6M4JQ30
Position
complement(3794676..3795350)
AA seq 224 aa
MKKTVIICIYIFLLLSGALVGLAKEETAQKSENQPVVIPDQAIRLRILANSDSDQDQQLK
RHIRDAVNKEITTWVKDITSIEEARRVIRSKLPEIKAIAKETMEKEGANQSISVDFDKIS
FPTKLYGNMVYPAGEYEAILITLGNGDGANWWCVLFPPLCFLDFSNGEAVKEQEDKEASK
KQTEKVLEDVTAKAEKAKKEENEEKEDGTEVKFFLVEWISDLFS
NT seq 675 nt   +upstreamnt  +downstreamnt
atgaaaaaaacagtaatcatttgtatatatatctttcttttattatccggagcgctcgta
gggctggcaaaagaagagacggcacaaaaatcggaaaatcagccggtggtcatacctgat
caggcgattcgtttgagaatactggcaaacagcgatagtgatcaagaccagcaattaaaa
cgtcatataagagacgcggtgaataaagaaatcacaacttgggtaaaggatattacttct
attgaagaagcgcgtcgcgtgattcgttcaaagctgcctgaaatcaaagcaattgcaaag
gaaacaatggagaaagaaggagcgaatcagtcgatatccgttgattttgacaaaatctcg
tttccgacaaagctttacggcaacatggtatatcccgctggtgagtatgaagcgattttg
attacgcttggaaacggagacggcgccaactggtggtgtgtgctgttcccgcccctctgc
tttcttgatttttctaacggggaagccgtcaaagaacaagaagataaagaagcctcaaaa
aagcagactgaaaaagtgcttgaggacgtaaccgctaaagcggaaaaagccaaaaaagaa
gagaacgaagaaaaagaagacggcacagaagtgaaattctttttagtcgaatggatttcc
gaccttttttcctaa

DBGET integrated database retrieval system