KEGG   Bacillus subtilis subsp. subtilis 168: BSU36980
Entry
BSU36980          CDS       T00010                                 

Symbol
ywlA
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: UPF0715 Peptidase_U4 TPPK_C AzlD
Other DBs
NCBI-GeneID: 938509
NCBI-ProteinID: NP_391579
Pasteur: BG10936
BSORF: BG10936
UniProt: P39150 A0A6M3ZLD0
Position
3795491..3795853
AA seq 120 aa
MKYNYTVLLSAFTMSVLYSVIYIHSFIIAALITMAFYFLFPYLIFALPLQIMMNKKPKRF
SPLYLLYYLAAAFIANAIIFGMLQPSGQSLFQNTAFYLFAVLTALIYWIWDSVLLQKKEA
NT seq 363 nt   +upstreamnt  +downstreamnt
atgaaatacaattatacagtgctgttatcagcattcacgatgtccgttctttattcagta
atttatattcattcatttatcattgccgctctcatcacaatggcattttattttctgttt
ccttatttgatcttcgcactgccgcttcaaatcatgatgaataaaaagccgaaacgtttc
agccctttgtatctgctgtattaccttgccgctgcttttattgccaacgcgatcattttc
ggcatgcttcagccttcgggacaatctctgtttcaaaatacagccttttatcttttcgct
gtattaacagctcttatctattggatatgggattctgttttactgcaaaaaaaggaagcc
taa

DBGET integrated database retrieval system