KEGG   Bacillus subtilis subsp. subtilis 168: BSU36990
Entry
BSU36990          CDS       T00010                                 

Symbol
ywkF
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DUF5316 ABC2_membrane DUF808 ResB MscS_TM
Other DBs
NCBI-GeneID: 938510
NCBI-ProteinID: NP_391580
Pasteur: BG11317
BSORF: BG11317
UniProt: P45874 A0A6M4JQ65
Position
complement(3795870..3796157)
AA seq 95 aa
MKKALTAGILLIAIESMIGTIFPQALSYEAIFGVASLVLVGLAIITSGLAVSGSDQRANY
HSETKEGRTSRMKMAAAFFVAAIPSILCYLLTILF
NT seq 288 nt   +upstreamnt  +downstreamnt
atgaaaaaggccctgacagcaggaatcctgctcattgcgattgagagcatgattggcacc
atttttccgcaggctctttcatatgaagcgatttttggcgttgcgtctctcgttttagtg
gggctcgcgatcattacatcgggtttggctgtaagcggaagcgatcagcgggcaaactac
cattcagaaaccaaagaaggccgtacatctcgcatgaaaatggcggccgctttctttgtt
gcggcgataccttccattctatgttatttactgacgattttgttttaa

DBGET integrated database retrieval system