KEGG   Bacillus subtilis subsp. subtilis 168: BSU37000
Entry
BSU37000          CDS       T00010                                 

Symbol
prmC
Name
(RefSeq) release factor glutamine methyltransferase
  KO
K02493  release factor glutamine methyltransferase [EC:2.1.1.297]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:bsu03012]
    BSU37000 (prmC)
Enzymes [BR:bsu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.297  peptide chain release factor N5-glutamine methyltransferase
     BSU37000 (prmC)
Translation factors [BR:bsu03012]
 Eukaryotic type
  Release factors
   BSU37000 (prmC)
 Prokaryotic type
   BSU37000 (prmC)
SSDB
Motif
Pfam: MTS Methyltransf_31 PrmC_N Methyltransf_25 PrmA Methyltransf_11 Cons_hypoth95 Methyltransf_32 Methyltransf_18 UPF0146 Methyltransf_12 UPF0020 Methyltransf_4 Methyltransf_15 Methyltransf_23 Ubie_methyltran Methyltransf_10 GidB Methyltransf_2 PCMT DUF43 Methyltransf_16 N6_Mtase Eco57I Met_10
Other DBs
NCBI-GeneID: 938511
NCBI-ProteinID: NP_391581
Pasteur: BG11316
BSORF: BG11316
UniProt: P45873 A0A6M3ZGY3
Position
complement(3796217..3797083)
AA seq 288 aa
MKTIFEALKWASSYLTEAGREENAAELLLLYDTGMERSKLLASLQEPIGEDELYRFKRHV
EMHKEGVPVQYIIGKEFFYGREFMVNDDVLIPRPETEEVVFHLLEKYRSVFSEDGKLEVV
DVGTGSGAIAVTLALENQSFSVSAVDISKEALQVASANAEKLGANVRFYQGDLLEPFIKA
GKKADIIVSNPPYISEEEMADLSEIVRFHEPLHALTDGGDGLKFYKRFMEDIPLVMKDKV
FVVFEIGWKQGAAVKDLILKAFKGAEVEVLKDINGKDRTICALIHKNK
NT seq 867 nt   +upstreamnt  +downstreamnt
atgaagacgatattcgaagccctgaaatgggcttcttcttatttaaccgaagcgggaaga
gaagaaaatgcggccgagctcctattgctttatgataccggaatggagagaagcaagctg
ctcgcaagcttacaggaaccgattggtgaagacgaactgtatcgctttaagcgtcacgtt
gagatgcataaagagggcgtgccggttcaatacattataggaaaagagtttttttatgga
cgggaatttatggtgaatgatgatgtgctgatcccgcggccggaaactgaagaagttgtc
tttcatttgcttgaaaaatatcggagtgttttttctgaagacggcaagctcgaagttgtt
gacgttggtacagggagcggcgcaatagccgtcacgcttgcgcttgaaaaccaaagcttt
tctgtgtcggcggtcgatatttcgaaagaggcgctgcaagtcgcctctgccaatgcagaa
aaactcggagcgaatgtgcgcttttatcagggcgatctgcttgagccttttattaaggcg
ggaaaaaaagcggatatcattgtctcaaacccgccatatatttcagaggaagaaatggct
gatttatcggaaattgtccgttttcatgagccgctgcacgcactcaccgatggcggagac
gggctgaaattttataagcggtttatggaagacattccgcttgttatgaaggataaagta
tttgtcgtttttgaaatcggctggaaacagggagcggcggtcaaagacctgatcctcaag
gcgtttaagggggcggaagtggaagtgctgaaagatattaatggaaaagacagaaccata
tgcgctctgattcataaaaataaataa

DBGET integrated database retrieval system