KEGG   Bacillus subtilis subsp. subtilis 168: BSU37010
Entry
BSU37010          CDS       T00010                                 

Gene name
prfA
Definition
(RefSeq) peptide chain release factor 1
  KO
K02835  peptide chain release factor 1
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:bsu03012]
    BSU37010 (prfA)
Translation factors [BR:bsu03012]
 Eukaryotic type
  Release factors
   BSU37010 (prfA)
 Prokaryotic type
   BSU37010 (prfA)
SSDB
Motif
Pfam: PCRF RF-1 ABC_tran_CTD MIR
Other DBs
NCBI-GeneID: 937031
NCBI-ProteinID: NP_391582
Pasteur: BG11244
BSORF: BG11244
UniProt: P45872 A0A6M4JRN8
Position
complement(3797085..3798155)
AA seq 356 aa
MLDRLKSIEERYEKLNELLSDPEVVNDPKKLREYSKEQSDIQETVDVYRQYRDASEQLAD
AKAMLEEKLDAEMRDMVKEEISELQKETETLSERLKVLLIPKDPNDDKNVIMEIRGAAGG
EEAALFAGNLYRMYSRYAELQGWKTEVMEANVTGTGGYKEIIFMITGSGAYSKLKYENGA
HRVQRVPETESGGRIHTSTATVACLPEAEEVEVDIHEKDIRVDTFASSGPGGQSVNTTMS
AVRLTHLPTGVVVSCQDEKSQIKNKEKAMKVLRARIYDKFQQEAQAEYDQTRKSAVGSGD
RSERIRTYNFPQNRVTDHRIGLTIQKLDQILEGKLDEVVEALIVEDQASKLQQSEG
NT seq 1071 nt   +upstreamnt  +downstreamnt
gtgttagaccgtttaaaatcaattgaagaacgatacgagaaattaaatgagcttttgagc
gatccagaagtagtcaacgatccgaaaaagctaagagaatattcaaaagagcaatctgat
atacaagaaacagttgacgtatatagacaatacagagatgcgtcagaacagctggctgat
gcaaaagcgatgcttgaagagaagctggatgctgagatgcgcgacatggtgaaggaagag
atttctgaacttcagaaggaaacggaaacactgtcagaacggctgaaggtgctcctgatc
ccgaaagatcctaatgacgacaaaaacgttatcatggagatccgcggggctgcgggaggc
gaggaagccgctttattcgcgggcaatctgtacagaatgtattcccgttatgctgagctt
cagggctggaaaacagaggtcatggaagcgaatgtaaccggaacgggcggctacaaagag
atcatctttatgattacaggaagcggcgcgtattctaaactcaaatatgaaaacggcgcc
caccgcgtacagcgtgttccggaaacagaatcaggcggacgcatccatacatccactgca
acagtggcatgtcttcctgaggcagaagaggtagaggtcgacatccatgagaaggatatc
cgtgtcgatacatttgcttcaagcggaccgggcggacaaagcgttaacacaacaatgtct
gcggttcgtctgactcacttgccgacaggtgttgttgtatcatgccaggatgaaaaatct
caaattaagaacaaagaaaaagcaatgaaggttctccgtgccagaatctatgataaattt
cagcaggaagcccaggctgaatatgatcaaacacggaaatcagcagtcggatctggtgac
cgctctgaacgtatccgcacatacaacttcccgcaaaaccgtgtgacggatcacagaatc
ggtttgacgattcaaaagcttgatcagattcttgaaggaaaacttgacgaagtggttgaa
gcgctgattgttgaagatcaggcaagcaagcttcagcagtcggaaggttaa

DBGET integrated database retrieval system