KEGG   Bacillus subtilis subsp. subtilis 168: BSU37020
Entry
BSU37020          CDS       T00010                                 

Symbol
ywkD
Name
(RefSeq) hypothetical protein
  KO
K08234  glyoxylase I family protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99985 Amino acid metabolism
    BSU37020 (ywkD)
SSDB
Motif
Pfam: Glyoxalase Glyoxalase_4 Glyoxalase_3 Glyoxalase_2 Glyoxalase_6 Exog_C DUF4269 Glyoxalase_7
Other DBs
NCBI-GeneID: 937039
NCBI-ProteinID: NP_391583
Pasteur: BG11315
BSORF: BG11315
UniProt: P45871 A0A6M3ZJ73
Position
3798281..3798667
AA seq 128 aa
MLLKSIHHIAIICSDYEKSKAFYVHKLGFQVIQETYREERGSYKLDLSLNGSYVIELFSF
PDPPERQTRPEAAGLRHLAFTVGSLDKAVQELHEKGIETEPIRTDPLTGKRFTFFFDPDQ
LPLELYEQ
NT seq 387 nt   +upstreamnt  +downstreamnt
atgttgctgaaatccatacatcatattgcaatcatatgttcagattacgaaaagtcgaaa
gctttctacgtacataagcttggttttcaggtgattcaagaaacgtaccgcgaagagcgc
ggctcctataagcttgatttgtcgcttaacggctcgtatgtcattgagctgttctcgttt
cccgatccgcccgaacgacaaacccggcctgaagccgcaggcctgcgccacctcgccttt
acagtcggcagcttggataaagctgttcaagagcttcatgaaaaaggaatcgaaacagag
ccaatcagaacagatccgctgaccggcaagcgtttcaccttcttttttgatcctgaccag
cttccattagaactgtatgaacaataa

DBGET integrated database retrieval system