KEGG   Bacillus subtilis subsp. subtilis 168: BSU37030
Entry
BSU37030          CDS       T00010                                 

Symbol
racA
Name
(RefSeq) chromosome-anchoring protein RacA
  KO
K11686  chromosome-anchoring protein RacA
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:bsu03036]
    BSU37030 (racA)
Chromosome and associated proteins [BR:bsu03036]
 Prokaryotic type
  Chromosome partitioning proteins
   Other chromosome partitioning proteins
    BSU37030 (racA)
SSDB
Motif
Pfam: MerR_1 HTH_Tnp_1_2 HTH_23 DUF1323 HTH_17 HTH_28 HTH_Tnp_1 HTH_Tnp_ISL3 HTH_29 YdaS_antitoxin HTH_36 HTH_13 DUF2730 MnmE_helical Fe_dep_repress MerR FERM_M Stathmin DUF2203 ABC_tran_CTD Fib_alpha CorA
Other DBs
NCBI-GeneID: 937043
NCBI-ProteinID: NP_391584
Pasteur: BG11314
BSORF: BG11314
UniProt: P45870 A0A6M4JQ73
Structure
PDB: 
5I41 5I44

Position
3798789..3799343
AA seq 184 aa
MNTNMVASELGVSAKTVQRWVKQLNLPAERNELGHYSFTAEDVKVLKSVQKQISEGTAIQ
DIHLPKSAKKRTGFLVQKTSSDTERRIEQLEQKLDTLLQQRQDESELMARMSELERQLKQ
KADEGVSYQLLQHRREIDDILADLQSLTSQMKEFTAHSIPETAAASEKTKTRKKPLLSLF
KFQT
NT seq 555 nt   +upstreamnt  +downstreamnt
atgaatacaaatatggtagcaagtgaactcggcgtctccgcaaagacggtgcagcggtgg
gtgaagcagctgaatcttccggccgaacgcaatgagctcggacactattcgttcacggca
gaagacgtgaaggttctaaaatccgttcaaaaacaaatctctgaaggcacggcgattcag
gatattcatctgccgaaaagcgctaaaaagcgcacaggcttccttgtccaaaaaacaagt
agcgacacagaacgaagaatcgagcagcttgaacaaaagctggacacccttttacagcaa
aggcaggacgaaagcgaattgatggcaaggatgtcggaactggaacgccagctgaaacaa
aaagccgatgaaggtgtatcttaccagctgcttcagcaccgcagagaaatcgatgatatt
cttgcagatctgcaatcactgacctcacaaatgaaagaattcaccgctcattcgatcccc
gagactgctgctgcttctgaaaaaaccaaaacaagaaaaaaaccgctgctgtcactgttc
aaatttcaaacctaa

DBGET integrated database retrieval system