KEGG   Bacillus subtilis subsp. subtilis 168: BSU37040
Entry
BSU37040          CDS       T00010                                 

Gene name
ywkB
Definition
(RefSeq) transporter
  KO
K13936  malonate transporter and related proteins
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU37040 (ywkB)
Transporters [BR:bsu02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   BSU37040 (ywkB)
SSDB
Motif
Pfam: Mem_trans
Other DBs
NCBI-GeneID: 936875
NCBI-ProteinID: NP_391585
Pasteur: BG11313
BSORF: BG11313
UniProt: P45869 A0A6M4JQ31
Position
complement(3799377..3800336)
AA seq 319 aa
MSILDILILLAPIFFVIVLGWFAGHFGSYDAKSAKGVSTLVTKYALPAHFIAGILTTSRS
EFLSQVPLMISLIIGIVGFYIIILLVCRFIFKYDLTNSSVFSLNSAQPTFAFMGIPVLGS
LFGANEVAIPIAVTGIVVNAILDPLAIIIATVGESSKKNEESGDSFWKMTGKSILHGLCE
PLAAAPLISMILVLVFNFTLPELGVKMLDQLGSTTSGVALFAVGVTVGIRKIKLSMPAIG
IALLKVAVQPALMFLIALAIGLPADQTTKAILLVAFPGSAVAAMIATRFEKQEEETATAF
VVSAILSLISLPIIIALTA
NT seq 960 nt   +upstreamnt  +downstreamnt
ttgagcatcttagatatcttaatcctcctggcgccgatcttctttgttatcgtgctgggt
tggtttgcaggacattttggaagttatgatgccaagtcggcaaaaggggtaagtacgtta
gtaacgaaatacgcacttccagctcactttatcgctggtattttgacaacttccagaagt
gaatttttatcacaagtacctttaatgatttctttaattattgggattgttggtttctat
atcatcattcttttggtttgcagatttatattcaagtatgatttaacgaactcatctgta
ttttctttgaactctgcacagccgacattcgcatttatgggtatcccggtattgggaagc
ttattcggagcgaatgaagttgcgattccgatcgcggtcacaggtatcgtggttaacgcg
attcttgatccgctcgcgatcattatcgctactgttggtgagtcttctaagaaaaacgaa
gagagtggcgacagcttctggaagatgacaggaaaatcaatcctgcatggtctttgtgag
ccgcttgcagctgctccgttaatcagtatgatcttggtgctggttttcaatttcactctt
cctgagctgggtgttaaaatgcttgatcagcttggaagcacaacatctggtgttgctctc
ttcgctgttggtgttaccgttggtattcgtaaaattaaactcagtatgccggctatcggt
attgcgttactaaaagttgcggttcagcctgcgttaatgttcctgattgctcttgctatc
ggacttccagctgaccaaacaacaaaagcaatccttcttgttgcattccctggttctgcc
gttgcagccatgattgcgactcgtttcgagaaacaagaagaagaaactgcaactgcgttt
gtggtcagtgcgattctgtcattgatttcacttccaatcattatcgcgcttactgcgtaa

DBGET integrated database retrieval system