KEGG   Bacillus subtilis subsp. subtilis 168: BSU37050
Entry
BSU37050          CDS       T00010                                 

Symbol
ywkA
Name
(RefSeq) NAD-dependent malic enzyme 2
  KO
K00027  malate dehydrogenase (oxaloacetate-decarboxylating) [EC:1.1.1.38]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00620  Pyruvate metabolism
bsu01200  Carbon metabolism
bsu02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BSU37050 (ywkA)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BSU37050 (ywkA)
Enzymes [BR:bsu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.38  malate dehydrogenase (oxaloacetate-decarboxylating)
     BSU37050 (ywkA)
SSDB
Motif
Pfam: Malic_M malic Pyr_redox_2
Other DBs
NCBI-GeneID: 937045
NCBI-ProteinID: NP_391586
Pasteur: BG11312
BSORF: BG11312
UniProt: P45868 A0A6M4JQ58
Position
complement(3800418..3802166)
AA seq 582 aa
MGYYLTWLTISRKKEICLNNIKKTKEGHLETTLRGKEVLSIPTLNKGVAFSLEERQELGL
EGLLPPTVLSLDQQAQRAYEQFQAQPDRLRQNVYLSDLANRNEVLFYKLLKNHLREMLPV
VYTPTVGEAIQEYSHEYRRPQGIYLSIDNIDGIEKAFENLHATAGDIDLIVATDSESILG
IGDWGVGGINIAIGKLAVYTAAAGIDPSRVIPVVLDVGTNNEKLLNDPLYIGNKHERVQG
ERYEAFIDAYVKAALKFFPKALLHWEDLGNKNARNIMKKYNHEILTFNDDIQGTGAITLA
GVLAAMKKTGASIKDQRVVIFGAGSAGIGIADQIRDTMVLAGLSEEEANKRFYTLDYRGL
LTEDIEGILDFQKPYLRNADEVKDWKRDEKGQIPFDEVVRQAKPTILIGTSGVSGAFTEE
IVKEMASHVDRPVIMPMSNPTHLAEAVPEDLFKWTDGKVLIATGSPFDNVEYNGVSYEIG
QSNNAFAFPGLGLGSIVAEARIITPAMFAATADAIAEMVDLETPGAGLLPSIDKLQEVSI
QVAIAVAEAAIKDGVANRQPEDVKQAVLDAMWTPEYKKVIAK
NT seq 1749 nt   +upstreamnt  +downstreamnt
atgggttattacttaacttggttaactatttcaagaaagaaggagatttgcttgaataac
ataaaaaaaacgaaagaaggccacttagaaacaactcttagaggaaaagaagttttatct
attcctactttaaataaaggcgttgctttttcactagaagaaagacaagaactcggctta
gaagggcttctgccgccaactgtactttctcttgatcaacaagcacaacgcgcgtacgag
caattccaagcgcagcctgaccgccttcgtcaaaatgtttacttaagtgatcttgcaaac
cgtaacgaagttcttttctataaattgctgaaaaaccatcttcgcgaaatgcttcctgtt
gtgtacacgccaacagttggtgaagcgattcaggaatacagccatgaatatagaagacct
caaggaatctacttgtcaatcgataacattgacggtattgaaaaagcgtttgaaaacctt
catgcgacagcaggcgatattgatcttatcgttgctactgactccgaaagcattctcggt
atcggtgactggggtgtaggcggtattaatattgcaatcggtaaattggctgtctacact
gctgcagctggtattgaccctagccgtgttatcccggttgtgcttgatgtcggtacgaac
aacgaaaaacttctaaacgatcctttatatattggtaacaagcatgaacgtgttcaaggt
gaacgctacgaagctttcattgacgcttatgtaaaagctgcattgaaattcttccctaaa
gcgcttcttcactgggaagaccttggcaacaaaaatgcacgcaacatcatgaaaaaatac
aatcatgaaatcctgacatttaatgatgatattcaaggtactggcgcgattacacttgca
ggtgtgcttgccgctatgaagaaaaccggcgcttctattaaagatcagcgtgttgttatc
ttcggtgctggttctgctggtatcggtattgctgaccaaatccgtgacacaatggtgcta
gccggattatctgaagaagaagctaacaaacgtttctacacacttgattacagaggcttg
ctgactgaagacatcgaaggcatccttgatttccaaaaaccttaccttcgcaatgcggat
gaagtgaaagactggaagcgcgatgaaaaaggtcaaattccattcgatgaagttgttcgt
caagcgaaaccaacaatcttgattggtacttcaggggtttcaggtgcattcacagaggaa
attgtaaaagaaatggcatctcacgtagaccgtccggttatcatgccgatgtctaacccg
actcaccttgctgaagctgttcctgaagatctgttcaaatggactgacggaaaagtgctt
attgcaacaggaagcccatttgacaatgtagaatacaacggtgtttcttatgaaatcgga
caatctaacaacgcattcgcgttccctggtcttggacttggttcaattgtagctgaagcg
cgtatcattacacctgctatgtttgctgcaactgctgatgcgattgctgaaatggttgat
cttgaaacacctggagcaggattgcttccaagcattgataagcttcaagaggtttctatc
caagttgcgattgccgttgctgaagcagcaattaaagacggcgtggcaaatcgtcagcct
gaagatgtgaaacaagcggtacttgatgcaatgtggacacctgaatacaaaaaagtcatc
gcgaaataa

DBGET integrated database retrieval system