KEGG   Bacillus subtilis subsp. subtilis 168: BSU37070
Entry
BSU37070          CDS       T00010                                 

Symbol
rpmE
Name
(RefSeq) 50S ribosomal protein L31
  KO
K02909  large subunit ribosomal protein L31
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu03010  Ribosome
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    BSU37070 (rpmE)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:bsu03011]
    BSU37070 (rpmE)
Ribosome [BR:bsu03011]
 Ribosomal proteins
  Bacteria
   Large subunit
    BSU37070 (rpmE)
SSDB
Motif
Pfam: Ribosomal_L31 AXH Alpha_E2_glycop
Other DBs
NCBI-GeneID: 937034
NCBI-ProteinID: NP_391588
Pasteur: BG10417
BSORF: BG10417
UniProt: Q03223 A0A6M3ZH72
Position
complement(3803081..3803281)
AA seq 66 aa
MKAGIHPNFKKATVKCACGNEFETGSVKEEVRVEICSECHPFYTGRQKFASADGRVDRFN
KKYGLK
NT seq 201 nt   +upstreamnt  +downstreamnt
atgaaagcaggaattcatcctaatttcaaaaaagcaacagttaaatgcgcttgcggaaat
gaatttgaaacaggctcagtaaaagaagaggtacgcgttgagatttgctctgaatgccac
ccattctacactggccgtcaaaaattcgcttctgctgatggtcgtgttgatcgctttaac
aaaaaatacggtcttaagtaa

DBGET integrated database retrieval system