KEGG   Bacillus subtilis subsp. subtilis 168: BSU37080
Entry
BSU37080          CDS       T00010                                 

Symbol
rho
Name
(RefSeq) transcription termination factor Rho
  KO
K03628  transcription termination factor Rho
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    BSU37080 (rho)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:bsu03021]
    BSU37080 (rho)
   03019 Messenger RNA biogenesis [BR:bsu03019]
    BSU37080 (rho)
Transcription machinery [BR:bsu03021]
 Prokaryotic type
  Bacterial type
   Other transcription-related factors
    Transcription termination factor
     BSU37080 (rho)
Messenger RNA biogenesis [BR:bsu03019]
 Prokaryotic type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     BSU37080 (rho)
SSDB
Motif
Pfam: Rho_RNA_bind ATP-synt_ab Rho_N OB_RNB AAA NACHT AAA_22 ATPase_2 Spore_III_AA Mor AAA_25
Other DBs
NCBI-GeneID: 937042
NCBI-ProteinID: NP_391589
Pasteur: BG10416
BSORF: BG10416
UniProt: Q03222
Position
complement(3803400..3804683)
AA seq 427 aa
MKDVSISSLENMKLKELYELARHYKISYYSKLTKKELIFAILKANAEQEDLLFMEGVLEI
IQSEGFGFLRPINYSPSSEDIYISASQIRRFDLRNGDKVSGKVRPPKENERYYGLLHVEA
VNGDDPESAKERVHFPALTPLYPDRQMVLETKPNFLSTRIMDMMAPVGFGQRGLIVAPPK
AGKTMLLKEIANSITANQPEAELIVLLIDERPEEVTDIERSVAGDVVSSTFDEVPENHIK
VAELVLERAMRLVEHKKDVIILMDSITRLARAYNLVIPPSGRTLSGGIDPAAFHRPKRFF
GAARNIEEGGSLTILATALVDTGSRMDDVIYEEFKGTGNMELHLDRSLAERRIFPAIDIR
RSGTRKEELLVPKEHLDRLWSIRKTMSDSPDFAEKFMRKMKKTKTNQEFFDILNQEWKQA
NLSSARR
NT seq 1284 nt   +upstreamnt  +downstreamnt
atgaaagacgtatctatttcctctttggaaaatatgaaattgaaagagctttatgaactt
gcaagacattataaaatctcctattacagcaaactgacaaaaaaagaactcattttcgcc
attctgaaagcgaatgcagaacaggaagatctgctgtttatggaaggcgttctcgagatc
atccagtctgaaggtttcggattcctgagaccgatcaactactctccaagctcagaagac
atttacatctcagcttcacaaatccgccgtttcgatttgcggaacggagacaaagtatct
ggcaaggttcgcccgccaaaagaaaatgagcgttactatggacttttgcacgttgaagca
gtaaatggggatgatcccgaatctgcaaaagagcgtgtgcatttcccggctcttacgcca
ctttatccggatcgtcaaatggtgcttgaaacaaagccgaacttcttgtctacaagaatt
atggacatgatggcgccggttggatttgggcagcgcggattgattgttgcgccgccgaaa
gccggaaaaacgatgttgctgaaggaaattgccaacagcattacagcgaaccagcctgaa
gcagagctgatcgtgcttttaattgacgaaagacctgaggaagtaaccgatatcgagcgc
tctgtagctggggatgtcgtcagctcaacgtttgatgaagtgccggaaaaccatatcaaa
gtggccgagcttgtgcttgaacgtgcgatgcgtctcgtggaacacaaaaaagacgtcatt
atcctgatggacagcatcacacgtcttgcccgcgcctacaacttagtgattccgccaagt
ggaagaacgctttccggggggattgacccagcggcgttccaccgtccgaaacgcttcttt
ggggctgcgagaaatatcgaagagggcggcagcttaaccatccttgctacggctctggtc
gatacaggttcacgtatggatgatgtcatttatgaagaattcaagggaacaggcaacatg
gagctccatcttgaccgctctcttgccgagcgccgcatcttccctgccatcgatatccgc
cgttcaggaacgcgcaaagaagagctgcttgtgcctaaagagcatcttgatcgtttatgg
tctatccgcaaaacgatgtctgattcacctgatttcgcagaaaagttcatgagaaaaatg
aaaaaaaccaaaacaaaccaggaatttttcgatattctcaatcaagaatggaaacaggca
aatctatcatctgcaagaaggtaa

DBGET integrated database retrieval system