KEGG   Bacillus subtilis subsp. subtilis 168: BSU37100
Entry
BSU37100          CDS       T00010                                 

Symbol
murAB
Name
(RefSeq) UDP-N-acetylglucosamine 1-carboxyvinyltransferase 2
  KO
K00790  UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00520  Amino sugar and nucleotide sugar metabolism
bsu00550  Peptidoglycan biosynthesis
bsu01100  Metabolic pathways
bsu01250  Biosynthesis of nucleotide sugars
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    BSU37100 (murAB)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BSU37100 (murAB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bsu01011]
    BSU37100 (murAB)
Enzymes [BR:bsu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     BSU37100 (murAB)
Peptidoglycan biosynthesis and degradation proteins [BR:bsu01011]
 Precursor biosynthesis
  Transferase/Dehydrogenase
   BSU37100 (murAB)
SSDB
Motif
Pfam: EPSP_synthase DUF2730
Other DBs
NCBI-GeneID: 937038
NCBI-ProteinID: NP_391591
Pasteur: BG10414
BSORF: BG10414
UniProt: P19670 A0A6M3ZLD4
Position
complement(3806086..3807375)
AA seq 429 aa
MEKLNIAGGDSLNGTVHISGAKNSAVALIPATILANSEVTIEGLPEISDIETLRDLLKEI
GGNVHFENGEMVVDPTSMISMPLPNGKVKKLRASYYLMGAMLGRFKQAVIGLPGGCHLGP
RPIDQHIKGFEALGAEVTNEQGAIYLRAERLRGARIYLDVVSVGATINIMLAAVLAEGKT
IIENAAKEPEIIDVATLLTSMGAKIKGAGTNVIRIDGVKELHGCKHTIIPDRIEAGTFMI
AGAAMGKEVIIDNVIPTHLESLTAKLREMGYHIETSDDQLLIVGGQKNLKPVDVKTLVYP
GFPTDLQQPMTALLTRAKGTSVVTDTIYSARFKHIDELRRMGANMKVEGRSAIITGPVEL
QGAKVKASDLRAGACLVVAGLMADGVTEITGLEHIDRGYSSLEKKLEGLGATIWRERMTD
EEIEQLQNS
NT seq 1290 nt   +upstreamnt  +downstreamnt
atggaaaagttgaatattgccggcggtgactcgttaaacggtacagtacatatcagcggc
gctaaaaacagcgctgttgcgttaatacctgcaaccattttggcaaattccgaggtgaca
attgaagggcttccagagatttcagatattgaaacgctgcgtgacctgttaaaggaaatc
ggcggcaacgtgcattttgagaatggggaaatggttgttgaccctacgtcgatgatcagc
atgccgcttcctaacgggaaagtaaaaaagcttcgcgcgtcatattatttaatgggggcg
atgctcggccgcttcaagcaggcggtcattggattgcctggcggctgtcacttagggccc
cgtccgattgatcagcatatcaaaggctttgaagcactcggagctgaagtaaccaatgaa
caaggcgccatttatttgcgagctgaaaggctgagaggcgcacggatttatttagatgtc
gtaagcgttggggcaacgattaacattatgctcgccgctgttttggcagaagggaaaacg
atcatcgaaaacgctgccaaggagcctgagatcattgacgtcgcgacattgcttaccagc
atgggcgccaaaatcaaaggtgcgggcaccaatgtgattcgaatcgacggcgtgaaggaa
ctgcacggctgcaagcatacgatcattccggacagaattgaagccgggacatttatgatt
gcaggggctgcaatgggcaaggaagtcattatcgataacgtcatccctactcatcttgag
tcgttaacggcaaagctgagagaaatgggctatcatatcgaaacaagcgacgaccagctc
ctcattgtcggcgggcagaagaacttaaagccggttgacgtcaaaaccctcgtatacccg
gggtttccgactgatttacagcagccgatgacggcgctcctgacaagggcgaaagggacg
agtgtcgtcacagacaccatctactcggcaagattcaagcacattgatgagctgagacga
atgggtgccaatatgaaagtagaaggcagatctgccatcatcacaggtcctgtcgagctt
caaggcgcaaaagtgaaggcgagtgatctgcgtgccggagcctgcttggtggtagccgga
ctgatggctgatggcgtcacggaaattacgggactggagcatattgaccgaggatacagc
agccttgagaagaagcttgaggggcttggagcgacaatttggcgtgaaagaatgactgac
gaagaaatagaacagcttcaaaattcataa

DBGET integrated database retrieval system