KEGG   Bacillus subtilis subsp. subtilis 168: BSU37110
Entry
BSU37110          CDS       T00010                                 

Symbol
ywjH
Name
(RefSeq) transaldolase
  KO
K00616  transaldolase [EC:2.2.1.2]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00030  Pentose phosphate pathway
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01120  Microbial metabolism in diverse environments
bsu01200  Carbon metabolism
bsu01230  Biosynthesis of amino acids
Module
bsu_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
bsu_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    BSU37110 (ywjH)
Enzymes [BR:bsu01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.2  transaldolase
     BSU37110 (ywjH)
SSDB
Motif
Pfam: TAL_FSA HTH_34
Other DBs
NCBI-GeneID: 938462
NCBI-ProteinID: NP_391592
Pasteur: BG10413
BSORF: BG10413
UniProt: P19669 A0A6M4JQ40
Structure
PDB: 
3R8R

Position
complement(3807754..3808392)
AA seq 212 aa
MLFFVDTANIDEIREANELGILAGVTTNPSLVAKEANVSFHDRLREITDVVKGSVSAEVI
SLKAEEMIEEGKELAKIAPNITVKIPMTSDGLKAVRALTDLGIKTNVTLIFNANQALLAA
RAGATYVSPFLGRLDDIGHNGLDLISEVKQIFDIHGLDTQIIAASIRHPQHVTEAALRGA
HIGTMPLKVIHALTKHPLTDKGIEQFLADWNK
NT seq 639 nt   +upstreamnt  +downstreamnt
atgttattctttgttgatacagccaatatcgatgaaattagagaagcgaatgaattagga
attctcgccggtgtaacgacgaatcctagtttagtagcaaaggaagctaacgtatcattc
cacgaccgtcttcgcgagatcacagacgtcgtgaaagggtctgtaagcgcagaggttatt
tctttgaaagctgaggaaatgatcgaggaaggaaaagaactggcgaagatcgctccgaac
attacggtgaaaatcccaatgacgtctgacggtttaaaagcggtaagagcacttactgac
ttaggcatcaaaacaaacgttacattgatcttcaatgccaaccaggcgcttcttgctgcc
agagcgggggcaacatatgtatctccattcctgggacgtttagatgacatcggccacaac
gggcttgacctgatttcagaagttaaacagatttttgacattcacggccttgacacgcaa
atcattgcagcgtcaatccgccatccgcagcacgtgacagaagctgctcttagaggggct
catatcggcacaatgccgctgaaagtcattcatgcgctcactaaacacccgttaacagac
aaaggaatcgaacaattcctggcagactggaacaaataa

DBGET integrated database retrieval system