KEGG   Bacillus subtilis subsp. subtilis 168: BSU37120
Entry
BSU37120          CDS       T00010                                 

Symbol
fbaA
Name
(RefSeq) fructose-bisphosphate aldolase
  KO
K01624  fructose-bisphosphate aldolase, class II [EC:4.1.2.13]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00010  Glycolysis / Gluconeogenesis
bsu00030  Pentose phosphate pathway
bsu00051  Fructose and mannose metabolism
bsu00680  Methane metabolism
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01120  Microbial metabolism in diverse environments
bsu01200  Carbon metabolism
bsu01230  Biosynthesis of amino acids
Module
bsu_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bsu_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
bsu_M00345  Formaldehyde assimilation, ribulose monophosphate pathway
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BSU37120 (fbaA)
   00030 Pentose phosphate pathway
    BSU37120 (fbaA)
   00051 Fructose and mannose metabolism
    BSU37120 (fbaA)
  09102 Energy metabolism
   00680 Methane metabolism
    BSU37120 (fbaA)
Enzymes [BR:bsu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     BSU37120 (fbaA)
SSDB
Motif
Pfam: F_bP_aldolase 4HFCP_synth
Other DBs
NCBI-GeneID: 937040
NCBI-ProteinID: NP_391593
Pasteur: BG10412
BSORF: BG10412
UniProt: P13243 A0A6M3ZGZ8
Position
complement(3808512..3809369)
AA seq 285 aa
MPLVSMTEMLNTAKEKGYAVGQFNLNNLEFTQAILQAAEEEKSPVILGVSEGAGRYMGGF
KTVVAMVKALMEEYKVTVPVAIHLDHGSSFESCAKAIHAGFTSVMIDASHHPFEENVATT
AKVVELAHFHGVSVEAELGTVGGQEDDVIAEGVIYADPKECQELVERTGIDCLAPALGSV
HGPYKGEPNLGFKEMEEIGKSTGLPLVLHGGTGIPTADIKKSISLGTAKINVNTENQISS
AKAVRETLAAKPDEYDPRKYLGPAREAIKETVIGKMREFGSSNQA
NT seq 858 nt   +upstreamnt  +downstreamnt
atgcctttagtttctatgacggaaatgttgaatacagctaaagaaaaagggtacgctgta
ggacaatttaacttaaacaaccttgagtttactcaagcgattttacaagcagctgaagaa
gaaaaatctccagtgatccttggtgtttccgaaggtgcgggacgctacatgggcggcttc
aaaacagtcgttgctatggtaaaagcacttatggaagagtacaaagtgacagttcctgtt
gcgattcacttagaccacggttcaagctttgaatcttgtgcgaaagcgattcatgcaggt
ttcacatctgtaatgatcgacgcttctcaccatccatttgaagaaaacgtagcaacaact
gctaaagttgttgagcttgctcatttccacggagtatctgtagaagctgagcttggaaca
gtaggcggacaagaagatgacgttatcgctgaaggcgtaatctacgctgatcctaaagag
tgccaagagcttgttgagcgcactggcatcgactgccttgcacctgcattaggttctgtt
cacggcccttacaaaggtgagccaaaccttggcttcaaagaaatggaagagatcggaaaa
tcaactggccttccgctagttcttcacggcggtactggaattccgactgctgacatcaaa
aaatcaatttcacttggtacagctaaaatcaacgtgaatactgaaaaccaaatttcttct
gcaaaagctgttcgcgaaacattggcagctaagcctgacgagtacgatccacgtaaatac
cttggaccagctcgtgaagcgatcaaagaaacagttatcggtaaaatgcgtgaatttggt
tcttcaaaccaagcttaa

DBGET integrated database retrieval system