KEGG   Bacillus subtilis subsp. subtilis 168: BSU37130
Entry
BSU37130          CDS       T00010                                 

Symbol
spo0F
Name
(RefSeq) sporulation initiation phosphotransferase F
  KO
K02490  two-component system, response regulator, stage 0 sporulation protein F
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02020  Two-component system
bsu02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BSU37130 (spo0F)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    BSU37130 (spo0F)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:bsu02022]
    BSU37130 (spo0F)
Two-component system [BR:bsu02022]
 Spo family
  KinABCDE-Spo0FA (sporulation control)
   BSU37130 (spo0F)
SSDB
Motif
Pfam: Response_reg
Other DBs
NCBI-GeneID: 937041
NCBI-ProteinID: NP_391594
Pasteur: BG10411
BSORF: BG10411
UniProt: P06628 A0A6M3ZHF6
Structure
PDB: 

Position
complement(3809550..3809924)
AA seq 124 aa
MMNEKILIVDDQYGIRILLNEVFNKEGYQTFQAANGLQALDIVTKERPDLVLLDMKIPGM
DGIEILKRMKVIDENIRVIIMTAYGELDMIQESKELGALTHFAKPFDIDEIRDAVKKYLP
LKSN
NT seq 375 nt   +upstreamnt  +downstreamnt
atgatgaatgaaaaaattttaatcgttgatgatcaatacggcattcgtattttgctaaat
gaagtgttcaataaagaaggctaccagacgtttcaggctgcgaacggcctgcaggcgctt
gacattgtgacaaaagaacggcccgaccttgtgctgttggacatgaaaattcccggcatg
gacggaatcgaaatcttaaaacggatgaaggtcattgacgaaaacatccgggtcattatc
atgacggcatacggagagctcgacatgatccaggaatcgaaggaattgggcgctctgacg
cactttgccaagccgtttgacatcgacgaaatcagagacgccgtcaaaaaatatctgccc
ctgaagtctaactga

DBGET integrated database retrieval system