KEGG   Bacillus subtilis subsp. subtilis 168: BSU37140
Entry
BSU37140          CDS       T00010                                 

Symbol
ywjG
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DUF2529 SIS_2 PA-IIL
Other DBs
NCBI-GeneID: 938459
NCBI-ProteinID: NP_391595
Pasteur: BG11053
BSORF: BG11053
UniProt: P06629 A0A6M4JQ42
Position
3810090..3810611
AA seq 173 aa
MLKIFTTQLTGIFSRIQDKESDAIEDGARLLAQAVISGHSIYLYGANELQGVFYEATESK
EPFPSVKAFPENAEEVTESDRVLMFCSGTGTAEEQELAKELYEKGAGVVCVSPAAKDSAG
IEQYCDVHIDSKLKMPLVPDEDGTRYGFPSLMTALYVYHALSFTLKEILQEYA
NT seq 522 nt   +upstreamnt  +downstreamnt
atgttgaaaatattcacgacgcagttaacaggtattttttcccgcattcaggataaggaa
tctgacgcgattgaagatggggcgcggctgcttgctcaagcggtgatcagcgggcattcc
atttatttatacggagcgaatgagcttcagggcgtcttttatgaggccaccgaaagcaaa
gaacccttcccatctgtcaaagcctttccagaaaacgctgaggaagtgacagaaagcgac
agggtgctgatgttttgctcagggacgggcacagccgaagaacaggagctcgcaaaagag
ctttatgaaaaaggtgcgggagtcgtatgcgtatcgcccgcagccaaagacagtgcggga
atagaacagtattgtgatgtgcatattgattctaaattaaaaatgccgcttgttcccgat
gaagacggcacccgttacgggtttccctctttaatgacagcactgtatgtctatcacgct
ttatcgtttacactaaaagaaattctgcaagagtatgcataa

DBGET integrated database retrieval system