KEGG   Bacillus subtilis subsp. subtilis 168: BSU37150
Entry
BSU37150          CDS       T00010                                 

Symbol
pyrG
Name
(RefSeq) CTP synthase
  KO
K01937  CTP synthase [EC:6.3.4.2]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00240  Pyrimidine metabolism
bsu01100  Metabolic pathways
bsu01240  Biosynthesis of cofactors
Module
bsu_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    BSU37150 (pyrG)
Enzymes [BR:bsu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.2  CTP synthase (glutamine hydrolysing)
     BSU37150 (pyrG)
SSDB
Motif
Pfam: CTP_synth_N GATase Peptidase_C26 GerPC CbiA
Other DBs
NCBI-GeneID: 937044
NCBI-ProteinID: NP_391596
Pasteur: BG10410
BSORF: BG10410
UniProt: P13242 A0A6M3ZH10
Position
complement(3810693..3812300)
AA seq 535 aa
MTKYIFVTGGVVSSLGKGIVAASLGRLLKNRGLNVTIQKFDPYINVDPGTMSPYQHGEVF
VTDDGAETDLDLGHYERFIDINLNKFSNVTTGKIYSTVLKKERRGDYLGGTVQVIPHITN
ELKDRVYRAGKETNADVVITEIGGTVGDIESLPFLEAIRQMKSDIGRENVMYIHCTLVPY
IKAAGELKTKPTQHSVKELRSLGIQPNIIVVRTEMPISQDMKDKIALFCDIDTKAVIECE
DADNLYSIPLELQKQGLDKLVCEHMKLACKEAEMSEWKELVNKVSNLSQTITIGLVGKYV
ELPDAYISVVESLRHAGYAFDTDVKVKWINAEEVTENNIAELTSGTDGIIVPGGFGDRGV
EGKIVATKYARENNIPFLGICLGMQVASIEYARNVLGLKGAHSAEIDPSTQYPIIDLLPE
QKDVEDLGGTLRLGLYPCKLEEGTKAFEVYQDEVVYERHRHRYEFNNEFRQQMEEQGFVF
SGTSPDGRLVEIIELKDHPWFVASQFHPEFKSRPTRPQPLFKGFIGASVEAANQK
NT seq 1608 nt   +upstreamnt  +downstreamnt
atgacgaaatatatttttgtaaccgggggagttgtatcctcacttggaaagggtattgta
gcagcttcattagggcgtttgctgaaaaaccgcggactgaacgtgacgattcaaaaattc
gatccatacatcaacgttgacccgggaacaatgagcccgtaccagcacggtgaagtattc
gtaacggatgacggcgctgaaacagacttggaccttggtcactatgagcgttttatcgac
attaacctgaataaattcagcaacgtgacaacaggtaaaatctattcaacagttcttaaa
aaagaacgccgcggagattaccttggaggaaccgtacaggtcattccgcacatcacaaac
gaattgaaagaccgtgtttaccgcgcagggaaagagacaaacgcagatgttgtcattaca
gaaatcggcggtactgtcggagacatcgaatcactgccattccttgaagcgatccgccaa
atgaagagcgacatcggccgtgaaaacgtaatgtacatccactgtacgctcgtgccttac
attaaagctgctggcgaattaaaaacaaaaccgacacagcacagcgtaaaagaattgcgc
agcttgggcattcagccaaacatcatcgtcgttcgtacagaaatgccgatttctcaagat
atgaaagataaaatcgcgcttttctgcgacatcgatacaaaagcggttattgaatgtgaa
gatgcggacaacctttactccattccgctggagcttcaaaaacaagggcttgataagctt
gtttgcgagcacatgaaattggcatgcaaagaagcggaaatgtccgagtggaaagagctt
gttaacaaagtcagcaacctgtctcaaacgattacaatcggccttgtcggcaaatacgtt
gagcttcctgacgcatacatttctgttgtcgagtctctccgccatgcgggctatgcgttt
gacacagatgtaaaagtgaagtggatcaacgcggaagaagtgacagaaaacaatatcgca
gaactcacaagcggaacagacggcatcattgtgccgggcggattcggagaccgcggtgtt
gaagggaaaatcgtcgcgacaaaatacgcgcgcgaaaacaacattccgttcttgggcatt
tgcttgggcatgcaggtggcgtctattgaatacgcacgaaacgtattgggcttaaaaggc
gctcactcagcggaaattgatccgtcaactcaatacccgatcattgatcttcttcctgaa
caaaaggatgttgaggatcttgggggaacgcttcgtctcggcctttacccttgtaagctt
gaagaaggcacgaaagcctttgaagtgtatcaggatgaagtggtgtacgagcgccaccgc
caccgctatgagtttaacaatgaattcagacagcaaatggaagagcaaggcttcgtattc
tcaggcacaagccctgatggacgccttgttgaaatcatcgagctgaaagaccacccttgg
ttcgtggcttctcagttccacccagagttcaagtcaagaccgacaagacctcagcctcta
ttcaaaggctttatcggagcgtctgtcgaagctgcaaatcagaagtaa

DBGET integrated database retrieval system