KEGG   Bacillus subtilis subsp. subtilis 168: BSU37160
Entry
BSU37160          CDS       T00010                                 

Symbol
rpoE
Name
(RefSeq) DNA-directed RNA polymerase subunit delta
  KO
K03048  DNA-directed RNA polymerase subunit delta
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu03020  RNA polymerase
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    BSU37160 (rpoE)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:bsu03021]
    BSU37160 (rpoE)
   03400 DNA repair and recombination proteins [BR:bsu03400]
    BSU37160 (rpoE)
Transcription machinery [BR:bsu03021]
 Prokaryotic type
  Bacterial type
   RNA polymerase
    Core subunits
     BSU37160 (rpoE)
DNA repair and recombination proteins [BR:bsu03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TCR (transcription coupled repair) factors
     DNA-directed RNA polymerase complex (RNAP)
      BSU37160 (rpoE)
SSDB
Motif
Pfam: HARE-HTH MID_pPIWI_RE DUF4777 BUD22
Other DBs
NCBI-GeneID: 937046
NCBI-ProteinID: NP_391597
Pasteur: BG10409
BSORF: BG10409
UniProt: P12464 A0A6M3ZHD9
Structure
PDB: 
4NC7 4NC8 2M4K 2KRC

Position
complement(3812542..3813063)
AA seq 173 aa
MGIKQYSQEELKEMALVEIAHELFEEHKKPVPFQELLNEIASLLGVKKEELGDRIAQFYT
DLNIDGRFLALSDQTWGLRSWYPYDQLDEETQPTVKAKKKKAKKAVEEDLDLDEFEEIDE
DDLDLDEVEEELDLEADDFDEEDLDEDDDDLEIEEDIIDEDDEDYDDEEEEIK
NT seq 522 nt   +upstreamnt  +downstreamnt
ttgggtatcaaacaatattcacaggaagagctaaaggaaatggctttagttgaaatcgct
cacgaattatttgaagaacataaaaaaccagttccttttcaggagcttttaaatgaaatc
gcatctttgctcggcgtgaaaaaagaagagcttggagaccgcattgctcaattttataca
gatttaaacattgacggccgcttcctggcgctttctgaccagacgtgggggcttcgcagc
tggtatccttatgatcagcttgatgaagaaactcagccgacagtcaaggcgaaaaagaaa
aaagcgaagaaagcagtcgaagaagatcttgatcttgacgagtttgaagagatcgacgaa
gacgaccttgatttggatgaagttgaggaagaactcgatcttgaagccgacgattttgac
gaagaagatcttgatgaagacgacgatgatcttgagatcgaagaagatattattgatgaa
gatgatgaagactatgatgatgaagaagaggaaattaaatag

DBGET integrated database retrieval system