KEGG   Bacillus subtilis subsp. subtilis 168: BSU37170
Entry
BSU37170          CDS       T00010                                 

Gene name
acdA
Definition
(RefSeq) acyl-CoA dehydrogenase
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Acyl-CoA_dh_1 Acyl-CoA_dh_N Acyl-CoA_dh_2 Acyl-CoA_dh_M HpaB_N Snf7
Other DBs
NCBI-GeneID: 938457
NCBI-ProteinID: NP_391598
Pasteur: BG11239
BSORF: BG11239
UniProt: P45867 A0A6M3ZH84
Position
complement(3813246..3814385)
AA seq 379 aa
MNFSLSEEHEMIRKLVRDFAKHEVAPTAAERDEQERFDRELFREMANLGLTGIPWPEDYG
GIGSDYLAYVIAVEELSKVCASTGVTLSAHISLCSWPLFAFGTEEQKTEYLTQLALGEKI
GAFALTEAGSGSDAGSMKTTAERIGDDYVLNGSKVFITNGGVADIYIVFAVTDPEKKKKG
VTAFIVEKDFEGFFTGKKEKKLGIRSSPTTEIMFEDCVVPASKRLGEEGEGFKIAMKTLD
GGRNGIAAQAVGIAQGALDAALQYAKERKQFGKSIAEQQGIAFKLADMATMIEASRLLTY
QAAWLESSGLPYGKASAMSKLMAGDTAMKVTTEAVQIFGGYGYTKDYPVERYMRDAKITQ
IYEGTQEIQRLVISRMLAD
NT seq 1140 nt   +upstreamnt  +downstreamnt
atgaatttttcattatcagaagaacatgagatgatacgaaaattggtgcgcgattttgcg
aagcatgaggtggccccgacagcggctgaacgggacgaacaagaacgcttcgatcgcgag
ctgtttcgggaaatggcaaatctgggcctgacgggaattccatggcctgaagattacggc
ggaattggaagtgactatttagcctacgtcatcgcggtggaagagctgtcaaaagtgtgc
gcctccaccggtgtgacgctttccgcccatatctctctttgcagctggccgctgtttgcc
tttgggacagaggaacagaagacagagtacttaacacagctggctctcggagagaaaatc
ggcgcattcgctttgaccgaagcagggtctggctctgacgccggcagcatgaaaacaact
gctgaacgaatcggcgatgactatgtgttaaatggttccaaagtgtttatcacaaacggc
ggcgttgctgatatttacattgtttttgccgtcaccgatcccgagaaaaagaaaaaaggc
gttaccgcttttatagtagaaaaggattttgaaggattttttacaggcaagaaagaaaag
aagctgggcatccgttcttcaccgacaacggaaatcatgttcgaagattgtgtagtgccc
gcatcaaagcgtctcggagaagaaggagaaggcttcaaaatcgcgatgaagacgcttgac
ggaggcagaaacggcatagctgcacaagctgtaggcatcgcccaaggagcgcttgatgcg
gcgcttcaatatgcaaaagagcgaaagcaattcggaaaatcgatcgccgagcagcagggc
atcgcttttaaactcgcggatatggcgacaatgatagaagcttcaaggctactgacctat
caggctgcatggttagaatcatcgggccttccatatggaaaagcttccgccatgtccaaa
ctgatggctggggatacggcgatgaaggtaacgaccgaagccgtgcagattttcggcggc
tacggctatacaaaagattatccggtagaacgctatatgcgtgatgcaaaaatcacgcaa
atctatgaaggcactcaagaaattcaaagactggtcatctccagaatgctcgcggattaa

DBGET integrated database retrieval system